KEGG   Bacteriovorax marinus SJ: BMS_1746Help
Entry
BMS_1746          CDS       T01659                                 

Gene name
dapD
Definition
2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
Orthology
K00674  
2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase [EC:2.3.1.117]
Organism
bmx  Bacteriovorax marinus SJ
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bmx01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bmx00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1728064..1728855
Genome map
AA seq 263 aa AA seqDB search
MNGIHKGRNMSELNWKEVLDLLEKGEIRSAEKKDGKWVANVAVKEAILASFKAGTLTEFS
HEHFHGFVDKHNLPPQKFTPEQGVRMVPGGTSVRRGSYIAKGVILMPPAYVNVGAYVDEG
TMIDSHALVGSCAQIGKNVHLSAGVQIGGVLEPVGLAPVIIEDNAFIGAGAVIVEGIQVL
KGAVIAPGVILSKGVPVYDCVNERMLEKGEPIPENAIVVPGTRPVNSKLAWAKDMGLNMN
CALIVKFRDEKSDASLELEQFLR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaattcataaaggaagaaatatgtcagaattaaattggaaagaagtattagat
ttattagaaaaaggtgaaattagatcagctgaaaagaaagacggaaaatgggttgccaat
gttgccgttaaagaagccatcctcgcctcttttaaagctggaactctcactgagttttca
catgagcacttccatggatttgtagacaaacataacttgccaccacagaaatttacgcca
gaacaaggggtacgtatggttccaggaggaacatcagtaagacgtggttcttatatcgct
aaaggcgttattctcatgccacctgcatatgtaaatgttggtgcttacgtggatgaagga
acaatgattgattcacatgcgcttgttggctcttgtgctcaaattggaaaaaatgttcac
ctctctgcaggtgttcaaattggtggtgtccttgagccagttgggcttgcaccagtaata
atcgaagataatgctttcatcggtgccggtgccgttatcgttgaaggaattcaagtgcta
aaaggtgcagtaattgctcctggtgttatcctctctaaaggtgttccagtttatgattgc
gtaaacgagagaatgctagaaaaaggtgaacctattcctgagaatgcaattgttgttcct
gggactagacctgtgaattcaaaactagcatgggccaaggatatgggactcaatatgaat
tgtgctcttattgtaaaattcagagatgagaaaagtgatgcttcactggagctagaacaa
tttttaagataa

DBGET integrated database retrieval system