KEGG   Bacteriovorax marinus: BMS_1746Help
Entry
BMS_1746          CDS       T01659                                 

Gene name
dapD
Definition
2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
Orthology
K00674  
2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase [EC:2.3.1.117]
Organism
bmx  Bacteriovorax marinus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BMS_1746 (dapD)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BMS_1746 (dapD)
Enzymes [BR:bmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.117  2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
     BMS_1746 (dapD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1728064..1728855
Genome map
AA seq 263 aa AA seqDB search
MNGIHKGRNMSELNWKEVLDLLEKGEIRSAEKKDGKWVANVAVKEAILASFKAGTLTEFS
HEHFHGFVDKHNLPPQKFTPEQGVRMVPGGTSVRRGSYIAKGVILMPPAYVNVGAYVDEG
TMIDSHALVGSCAQIGKNVHLSAGVQIGGVLEPVGLAPVIIEDNAFIGAGAVIVEGIQVL
KGAVIAPGVILSKGVPVYDCVNERMLEKGEPIPENAIVVPGTRPVNSKLAWAKDMGLNMN
CALIVKFRDEKSDASLELEQFLR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaattcataaaggaagaaatatgtcagaattaaattggaaagaagtattagat
ttattagaaaaaggtgaaattagatcagctgaaaagaaagacggaaaatgggttgccaat
gttgccgttaaagaagccatcctcgcctcttttaaagctggaactctcactgagttttca
catgagcacttccatggatttgtagacaaacataacttgccaccacagaaatttacgcca
gaacaaggggtacgtatggttccaggaggaacatcagtaagacgtggttcttatatcgct
aaaggcgttattctcatgccacctgcatatgtaaatgttggtgcttacgtggatgaagga
acaatgattgattcacatgcgcttgttggctcttgtgctcaaattggaaaaaatgttcac
ctctctgcaggtgttcaaattggtggtgtccttgagccagttgggcttgcaccagtaata
atcgaagataatgctttcatcggtgccggtgccgttatcgttgaaggaattcaagtgcta
aaaggtgcagtaattgctcctggtgttatcctctctaaaggtgttccagtttatgattgc
gtaaacgagagaatgctagaaaaaggtgaacctattcctgagaatgcaattgttgttcct
gggactagacctgtgaattcaaaactagcatgggccaaggatatgggactcaatatgaat
tgtgctcttattgtaaaattcagagatgagaaaagtgatgcttcactggagctagaacaa
tttttaagataa

DBGET integrated database retrieval system