KEGG   Bacteriovorax marinus SJ: BMS_1913Help
Entry
BMS_1913          CDS       T01659                                 

Gene name
phoB
Definition
alkaline phosphatase III
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bmx  Bacteriovorax marinus SJ
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmx00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bmx00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bmx02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1906867..1908498
Genome map
AA seq 543 aa AA seqDB search
MSKNLFTLLCLTLLLSCNKQNKDVSKGDYYQRNGKVKNVIFVIGDGMGPQQLSMLQLFAK
HAKKDYFDNRVTNLEKLMAQGNLASVMTNPGKHLVVDSSCSATQYSTGEYSLPEVVGLDY
NGESSKTILELAKEKGLRTGLVSDTRLTHATPASYAAHNISRNDENAIAKEMIETGADVM
LSGGLRYFIPKNAQEDVELRNLVPKHISLKSKRVDNLNLLEVASNKNYQLVFDKSSLLKS
ERGKLLGLFENSSMPDGIWNTTNKDKADRVIPTLSEMAKVALKNLEGSKEGFFLMIEPGQ
IDWAGHRNDTGLLLHEMLRADDLFGVLNEWMKGREDTLLVVTADHETGGFGFSYSGYNVL
TPLKVSGEKFNGNDYRANYNYGDFDTLDTLYLQSKSTMELMLEVSKWKEEKRTTENLKKF
FSSHMKYEFSDEDIAMLMKSSKNQFYRPDHKNLKLKEVPHIEDFAAFYTYGNIVRSNIFA
RVLAHKQSAVWATGSHTSTPVTMITVGPKSLTSEFGGLLHSTQVGRKTIEALGLKKEYKT
KIK
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaatctctttactcttctgtgtctaacactcttactctcttgtaataaacaa
aataaagacgtttcaaaaggcgactactaccaaagaaatgggaaagtaaagaatgtcatt
tttgtaattggagatggtatggggccacagcaattatctatgctacagctctttgccaaa
catgctaagaaagactactttgacaatagagttaccaatttagaaaaacttatggcccaa
ggaaatctggcctcagttatgacaaatccaggtaagcacttagtagtggactcctcttgc
tcggccactcaatactctaccggtgaatactcacttccagaggttgttggacttgattat
aacggagagagctcaaagacaatcttagagttagctaaagaaaagggactaagaacaggt
ctagtttccgatacaagactcacccatgcgactcccgcctcttatgctgctcataatatt
tctagaaatgatgaaaacgccattgctaaagagatgattgaaacaggtgcagacgttatg
ctctctgggggcctaagatactttatcccaaagaatgctcaggaagatgttgaactcaga
aatcttgttccaaagcatatttctctcaaatcaaaacgtgttgataatctcaacctttta
gaagtggccagcaataagaattatcaacttgtttttgataagtcttcgctcttaaaaagt
gagagaggaaagcttctaggcctctttgaaaattcctctatgccagacggtatctggaac
accactaataaagataaggccgatagagttatccctactcttagtgaaatggcgaaagtt
gcccttaagaatctagaaggttctaaagaaggcttcttcctaatgattgaacctggacag
attgattgggcaggtcatagaaatgatacaggactcctcttacatgaaatgttacgcgca
gatgatctctttggtgtactcaacgagtggatgaaaggtagagaggacactcttcttgtc
gtgacagcagatcatgagacaggaggatttggttttagttatagtggttacaatgttcta
actccgctaaaagttagtggagagaaatttaatggcaatgactacagggccaattataat
tatggagactttgatacactagacacactctacctacagtctaagtcgactatggagtta
atgcttgaggtgagcaagtggaaagaagagaagagaacaactgagaatctaaaaaaattc
ttctcctctcatatgaagtatgaattctcagatgaagacattgctatgttgatgaaaagc
tctaagaatcaattctatagacctgatcacaagaatctaaaactaaaagaagttcctcat
attgaagactttgcggccttctacacttatggaaatatcgtaagatcaaatatatttgct
agagtacttgctcataagcaaagtgctgtatgggcaacaggctcacacacatcgacacca
gtaacaatgatcactgttggtcctaagagtttaacaagtgaatttggagggcttcttcac
tcaacgcaagttggaagaaagactattgaggccctcggacttaagaaggaatataagacg
aagattaaataa

DBGET integrated database retrieval system