KEGG   Bacteriovorax marinus: BMS_1913Help
Entry
BMS_1913          CDS       T01659                                 

Gene name
phoB
Definition
alkaline phosphatase III
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bmx  Bacteriovorax marinus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMS_1913 (phoB)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BMS_1913 (phoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMS_1913 (phoB)
Enzymes [BR:bmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BMS_1913 (phoB)
Exosome [BR:bmx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BMS_1913 (phoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1906867..1908498
Genome map
AA seq 543 aa AA seqDB search
MSKNLFTLLCLTLLLSCNKQNKDVSKGDYYQRNGKVKNVIFVIGDGMGPQQLSMLQLFAK
HAKKDYFDNRVTNLEKLMAQGNLASVMTNPGKHLVVDSSCSATQYSTGEYSLPEVVGLDY
NGESSKTILELAKEKGLRTGLVSDTRLTHATPASYAAHNISRNDENAIAKEMIETGADVM
LSGGLRYFIPKNAQEDVELRNLVPKHISLKSKRVDNLNLLEVASNKNYQLVFDKSSLLKS
ERGKLLGLFENSSMPDGIWNTTNKDKADRVIPTLSEMAKVALKNLEGSKEGFFLMIEPGQ
IDWAGHRNDTGLLLHEMLRADDLFGVLNEWMKGREDTLLVVTADHETGGFGFSYSGYNVL
TPLKVSGEKFNGNDYRANYNYGDFDTLDTLYLQSKSTMELMLEVSKWKEEKRTTENLKKF
FSSHMKYEFSDEDIAMLMKSSKNQFYRPDHKNLKLKEVPHIEDFAAFYTYGNIVRSNIFA
RVLAHKQSAVWATGSHTSTPVTMITVGPKSLTSEFGGLLHSTQVGRKTIEALGLKKEYKT
KIK
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaatctctttactcttctgtgtctaacactcttactctcttgtaataaacaa
aataaagacgtttcaaaaggcgactactaccaaagaaatgggaaagtaaagaatgtcatt
tttgtaattggagatggtatggggccacagcaattatctatgctacagctctttgccaaa
catgctaagaaagactactttgacaatagagttaccaatttagaaaaacttatggcccaa
ggaaatctggcctcagttatgacaaatccaggtaagcacttagtagtggactcctcttgc
tcggccactcaatactctaccggtgaatactcacttccagaggttgttggacttgattat
aacggagagagctcaaagacaatcttagagttagctaaagaaaagggactaagaacaggt
ctagtttccgatacaagactcacccatgcgactcccgcctcttatgctgctcataatatt
tctagaaatgatgaaaacgccattgctaaagagatgattgaaacaggtgcagacgttatg
ctctctgggggcctaagatactttatcccaaagaatgctcaggaagatgttgaactcaga
aatcttgttccaaagcatatttctctcaaatcaaaacgtgttgataatctcaacctttta
gaagtggccagcaataagaattatcaacttgtttttgataagtcttcgctcttaaaaagt
gagagaggaaagcttctaggcctctttgaaaattcctctatgccagacggtatctggaac
accactaataaagataaggccgatagagttatccctactcttagtgaaatggcgaaagtt
gcccttaagaatctagaaggttctaaagaaggcttcttcctaatgattgaacctggacag
attgattgggcaggtcatagaaatgatacaggactcctcttacatgaaatgttacgcgca
gatgatctctttggtgtactcaacgagtggatgaaaggtagagaggacactcttcttgtc
gtgacagcagatcatgagacaggaggatttggttttagttatagtggttacaatgttcta
actccgctaaaagttagtggagagaaatttaatggcaatgactacagggccaattataat
tatggagactttgatacactagacacactctacctacagtctaagtcgactatggagtta
atgcttgaggtgagcaagtggaaagaagagaagagaacaactgagaatctaaaaaaattc
ttctcctctcatatgaagtatgaattctcagatgaagacattgctatgttgatgaaaagc
tctaagaatcaattctatagacctgatcacaagaatctaaaactaaaagaagttcctcat
attgaagactttgcggccttctacacttatggaaatatcgtaagatcaaatatatttgct
agagtacttgctcataagcaaagtgctgtatgggcaacaggctcacacacatcgacacca
gtaacaatgatcactgttggtcctaagagtttaacaagtgaatttggagggcttcttcac
tcaacgcaagttggaagaaagactattgaggccctcggacttaagaaggaatataagacg
aagattaaataa

DBGET integrated database retrieval system