KEGG   Halobacteriovorax marinus: BMS_1937Help
Entry
BMS_1937          CDS       T01659                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bmx  Halobacteriovorax marinus
Pathway
bmx00240  Pyrimidine metabolism
bmx00250  Alanine, aspartate and glutamate metabolism
bmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BMS_1937 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMS_1937 (pyrB)
Enzymes [BR:bmx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BMS_1937 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CBW26753
UniProt: E1X2I6
Position
1934442..1935392
Genome map
AA seq 316 aa AA seqDB search
MENFPSVLESIKDLNKRQIDGVLNLAHKLKNRSDTRFSFPNKTPIIATSFLENSTRTKHS
FEIAISKLGCTYIDFDAETSSLKKGETLKQTLLTLNDQGVDLCVIRTSVSNQLSEFKEQP
PIKIINGGDGTNEHPTQALLDVFTLIENNISLEGKVFCIAGDNIHSRVGHSLIELLPQFG
AKVLLFGPKEYLPNITTDKNITITHSRDEVLEKADILYLLRIQTERHGNLKSIENYSEQY
GFTLKMIEALNKKLPVLHPGPANIGVEICEELINSKYYLGHEQVRNSIYLRMALVQSMLQ
NGAKNIGFEENTFFKF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggagaacttcccctctgttttagagtcaattaaagacttgaataagcggcaaattgat
ggagtccttaacttggcccataaattaaaaaaccgctcagacacccgtttctcttttcca
aataaaacaccaatcattgccacctcttttctcgaaaattcaactagaacaaaacactcc
tttgaaatagctatttcaaagcttggttgtacttatattgattttgatgctgaaacttcg
tctctaaaaaaaggtgagacccttaagcagacactccttactctaaatgatcaaggagta
gatttatgtgtgatcagaacatcggtttctaatcagctcagtgaatttaaagaacagccc
cctattaagatcataaacggtggagatgggactaacgagcacccgacacaggccctttta
gatgtattcaccttaatagagaataatatatcattagaaggaaaggtcttctgcattgct
ggtgacaatattcactctcgtgtaggacattcccttattgaactactcccacaatttggg
gcgaaggttttattatttggtcccaaagaatatttaccaaatatcaccacagataaaaat
atcactatcactcactctagagatgaagttttagagaaagcggacatcttatacctctta
agaattcaaacagagaggcatgggaatttaaagagtatagaaaattatagcgaacagtat
ggctttacgcttaaaatgatagaagcactaaataagaaacttccagtcctccatcccggc
cctgccaatataggtgttgagatctgtgaagagttaattaattcaaaatactacttaggt
catgaacaagtgagaaattcaatctacttaagaatggccctagttcaatctatgttacaa
aacggagcaaagaacattgggttcgaagaaaatacattttttaaattctaa

DBGET integrated database retrieval system