KEGG   Bacteriovorax marinus: BMS_2000Help
Entry
BMS_2000          CDS       T01659                                 

Gene name
echA8
Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bmx  Bacteriovorax marinus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BMS_2000 (echA8)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BMS_2000 (echA8)
   00650 Butanoate metabolism
    BMS_2000 (echA8)
  Lipid metabolism
   00071 Fatty acid degradation
    BMS_2000 (echA8)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMS_2000 (echA8)
   00310 Lysine degradation
    BMS_2000 (echA8)
   00360 Phenylalanine metabolism
    BMS_2000 (echA8)
   00380 Tryptophan metabolism
    BMS_2000 (echA8)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BMS_2000 (echA8)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BMS_2000 (echA8)
   00281 Geraniol degradation
    BMS_2000 (echA8)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMS_2000 (echA8)
   00627 Aminobenzoate degradation
    BMS_2000 (echA8)
   00930 Caprolactam degradation
    BMS_2000 (echA8)
Enzymes [BR:bmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BMS_2000 (echA8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2013241..2014020
Genome map
AA seq 259 aa AA seqDB search
MSELLTTHPYNNDLRVALLQLNRPKVLNALTTDLLQEIVDELRRLDDLPEVRCIILTGND
KAFAAGADILKMSQSNPIEQLTDKRMRLWKEFAMISKPIIAAVNGFALGGGHELAMACDF
VIAGDSAKFGQPEINIGTTPGAGGTQRLTRALGKSKAMMLALTGEMLSAMDAYECNLIAR
VVPAKTLLQECFEVAKKIADKSPIAVKLTKDSINKSQELSLSDGLEYERRNFYLSFASAD
QKEGMSAFLEKRAPEYKGN
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaattactaacgacacatccatataataatgatctaagggttgctcttctacaa
cttaatcgccccaaagttctcaatgctctcacgacagatcttcttcaagagatcgttgat
gagctaagaaggctagacgatcttccagaagtaagatgtattattctcacaggtaatgat
aaggcctttgcggcgggcgcagacattctaaagatgtctcagtccaaccctatcgaacaa
ctaacagataagaggatgaggctttggaaagagtttgctatgatttctaaaccaattatt
gcagcagttaatggcttcgctcttggtggtggtcatgagcttgccatggcctgtgatttt
gttattgcaggagatagcgctaaatttggacaaccagaaattaatatagggacaactcca
ggggcaggcgggactcagagattaactcgtgctctaggtaagagtaaagcgatgatgctt
gctctaactggtgaaatgctcagtgctatggacgcctatgagtgcaacctcattgctaga
gttgttccggccaaaactctattacaagaatgctttgaagtggccaagaaaatagctgac
aagtcacctatagctgtaaaattaacaaaagattccatcaataaatcacaggagctctcc
cttagtgacgggcttgagtatgagagaagaaatttctatttaagttttgcctctgctgat
caaaaagaaggaatgagtgcttttttagaaaagagagcaccagagtataaaggaaattaa

DBGET integrated database retrieval system