KEGG   Bacteriovorax marinus SJ: BMS_2246Help
Entry
BMS_2246          CDS       T01659                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bmx  Bacteriovorax marinus SJ
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bmx00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2269439..2270545
Genome map
AA seq 368 aa AA seqDB search
MSKNIIDTTKSLLCPPGNGVFTVNTAKERKDKLHQALYKTTANIEQLWKDSIEENLESSS
PLLLGVCSDTGGGIQRGANWGPLFLRNTLLEEHPELNYKDIGDIRVIPHLLHDKYLNDKT
IENCRKALYDNGDSEHPVSALSLTEEFCDQLFENFPKKKLFSIGGDHSVSYPLVKSYLRA
KKKQGIKAAIIHFDAHTDLLVERLGIDICFGSWCTHILPFLDSPECLIQLGIRSSGKDRS
HWENTFGVQQFWASEINKEGARSIAKRILNFLKKEEIDELYVSFDIDALDETYASATGTP
EPGGLNPEQSISIIKELAKEFKITGADMVEIAPLVCADHVNHPEPQTTLSIGAAISACLI
EAMDSDNS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaatataatcgatacaacgaagagcttactatgtcctccaggtaatggagtc
ttcacagtcaatactgcaaaagagagaaaggataaactccatcaagctctctataaaaca
accgcaaatattgagcaactttggaaagactcaattgaagagaatttagagagctcatct
cctcttcttttgggagtttgtagtgatacaggtggcggcattcaaagaggagcaaattgg
ggacccctctttcttagaaatactcttcttgaggaacatcctgagctcaactataaagat
atcggagatattagagtcatcccccatctgctacacgataagtatctcaatgataaaaca
atagagaattgtagaaaggccctctacgataatggtgattctgaacacccagtgagtgca
ctaagtcttactgaagaattctgcgaccaattatttgaaaattttccaaagaaaaagcta
ttttcaattggtggagatcactctgtgagttatccgcttgtaaagagttatttaagagca
aagaagaagcaaggaatcaaggccgcaatcatacactttgatgcccatacagacctactc
gttgaaagactaggaatcgatatttgctttggtagttggtgtacgcacattcttcccttt
ctagactctcctgagtgcttaatacagctaggaattagatcaagtggaaaagatcgctca
cattgggaaaatacatttggtgttcagcaattttgggccagcgaaataaataaagagggc
gctaggagtattgcaaagagaattctaaatttcctaaagaaagaagagattgatgaactc
tatgttagctttgatattgatgccctagatgaaacttatgccagtgccacaggaacacct
gaaccaggcggactaaatccagaacaatctatatcaataattaaagaacttgctaaagaa
tttaaaatcacaggcgctgatatggtagaaattgcacctctagtatgtgcagaccatgta
aatcaccctgagccacaaacaaccttaagtataggtgcggccatttccgcatgcttaatc
gaggcaatggatagtgacaattcttaa

DBGET integrated database retrieval system