KEGG   Halobacteriovorax marinus: BMS_2257Help
Entry
BMS_2257          CDS       T01659                                 

Gene name
odhB
Definition
(GenBank) putative dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmx  Halobacteriovorax marinus
Pathway
bmx00020  Citrate cycle (TCA cycle)
bmx00310  Lysine degradation
bmx01100  Metabolic pathways
bmx01110  Biosynthesis of secondary metabolites
bmx01120  Microbial metabolism in diverse environments
bmx01130  Biosynthesis of antibiotics
bmx01200  Carbon metabolism
Module
bmx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bmx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMS_2257 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BMS_2257 (odhB)
Enzymes [BR:bmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BMS_2257 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 Adeno_VII DUF4164
Motif
Other DBs
NCBI-ProteinID: CBW27059
UniProt: E1X487
Position
complement(2283979..2285199)
Genome map
AA seq 406 aa AA seqDB search
MSIEIKIPSIGESITEVTLAAWLKESGDYVEEGEILCEIESDKATVELPAESSGILTIAD
SAEEGAELEIGAVIATLDTSAEAPAGGASAPKEDAAPAPVAEAAPASGGDKNYPSPAAKK
ILDEKGIATDSVSGSGKDGRITKADALSAKGSSASAAAPAPSAPEQVVLSGGVSREKRVE
KMTRLRKTIAKRLTEAKNETAMLTTFNEVDMHNVMALRSKYKDAFKDKHDIGLGFMSFFT
KACTMALKEVPGVNAQIDGENIVYHDYADVGIAVSTPKGLVVPVVRNAESMSLAQIEKEI
RRLALKGRDGKLGIDEMQGGTFTITNGGVFGSMLSTPIINIPQSAILGMHNIVERPVAIN
GQVVIHPVMYLALSYDHRIVDGKESVTFLKTVKELIEDPSRMLLDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgaaattaaaattccaagtattggagaatcgattactgaagttacattagct
gcttggttaaaagaaagtggtgactacgttgaagagggagagatcctctgtgaaatcgag
tcagacaaagcaaccgtagaacttcctgctgaatctagcggaattttaactattgccgat
tctgcagaagaaggggcagagttagagattggtgctgttattgcgaccctcgatacaagt
gctgaagctcctgctggaggagcaagtgctccaaaagaagatgcggcacctgcaccagtt
gcagaagctgcgccagcaagtggtggagataagaattatccttctcctgcagctaagaaa
atattagatgaaaaaggaattgctactgattctgttagtggttctggcaaagacggaaga
attactaaagccgatgctcttagtgcaaaaggttcaagtgctagtgcagctgctccagct
ccaagtgctcctgagcaagttgtgctaagtggtggagtaagtcgtgagaagagagttgag
aaaatgactcgtcttagaaagactattgctaagcgcttaacagaagctaagaatgaaaca
gcaatgcttacaacttttaatgaagtggatatgcacaatgtgatggcccttcgttcaaaa
tataaagatgcttttaaagataagcacgacatcggtctagggtttatgtctttctttact
aaggcctgtactatggcattgaaagaggttcctggagttaatgctcaaatcgatggtgag
aatattgtttatcacgactacgctgatgttgggatcgcggtttcaactcctaaaggttta
gttgttccagtggtaagaaatgcagagagcatgagcttagcacaaatagagaaagaaatt
cgtagacttgctcttaaagggcgtgatggaaagctaggtattgatgaaatgcaaggtgga
acatttacgatcactaatggtggagtctttggatctatgctttcaactccaattattaat
attccacaatctgcaatcttaggaatgcataatattgtagagagaccagtggccattaat
ggtcaggttgttattcaccctgtgatgtacttagcactatcttatgatcacagaattgta
gatggaaaagagtctgtaacattccttaaaacagttaaggaattaattgaagatccttca
agaatgttactagatatctaa

DBGET integrated database retrieval system