KEGG   Bacteriovorax marinus: BMS_2257Help
Entry
BMS_2257          CDS       T01659                                 

Gene name
odhB
Definition
putative dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmx  Bacteriovorax marinus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMS_2257 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMS_2257 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    BMS_2257 (odhB)
Enzymes [BR:bmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BMS_2257 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2283979..2285199)
Genome map
AA seq 406 aa AA seqDB search
MSIEIKIPSIGESITEVTLAAWLKESGDYVEEGEILCEIESDKATVELPAESSGILTIAD
SAEEGAELEIGAVIATLDTSAEAPAGGASAPKEDAAPAPVAEAAPASGGDKNYPSPAAKK
ILDEKGIATDSVSGSGKDGRITKADALSAKGSSASAAAPAPSAPEQVVLSGGVSREKRVE
KMTRLRKTIAKRLTEAKNETAMLTTFNEVDMHNVMALRSKYKDAFKDKHDIGLGFMSFFT
KACTMALKEVPGVNAQIDGENIVYHDYADVGIAVSTPKGLVVPVVRNAESMSLAQIEKEI
RRLALKGRDGKLGIDEMQGGTFTITNGGVFGSMLSTPIINIPQSAILGMHNIVERPVAIN
GQVVIHPVMYLALSYDHRIVDGKESVTFLKTVKELIEDPSRMLLDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtattgaaattaaaattccaagtattggagaatcgattactgaagttacattagct
gcttggttaaaagaaagtggtgactacgttgaagagggagagatcctctgtgaaatcgag
tcagacaaagcaaccgtagaacttcctgctgaatctagcggaattttaactattgccgat
tctgcagaagaaggggcagagttagagattggtgctgttattgcgaccctcgatacaagt
gctgaagctcctgctggaggagcaagtgctccaaaagaagatgcggcacctgcaccagtt
gcagaagctgcgccagcaagtggtggagataagaattatccttctcctgcagctaagaaa
atattagatgaaaaaggaattgctactgattctgttagtggttctggcaaagacggaaga
attactaaagccgatgctcttagtgcaaaaggttcaagtgctagtgcagctgctccagct
ccaagtgctcctgagcaagttgtgctaagtggtggagtaagtcgtgagaagagagttgag
aaaatgactcgtcttagaaagactattgctaagcgcttaacagaagctaagaatgaaaca
gcaatgcttacaacttttaatgaagtggatatgcacaatgtgatggcccttcgttcaaaa
tataaagatgcttttaaagataagcacgacatcggtctagggtttatgtctttctttact
aaggcctgtactatggcattgaaagaggttcctggagttaatgctcaaatcgatggtgag
aatattgtttatcacgactacgctgatgttgggatcgcggtttcaactcctaaaggttta
gttgttccagtggtaagaaatgcagagagcatgagcttagcacaaatagagaaagaaatt
cgtagacttgctcttaaagggcgtgatggaaagctaggtattgatgaaatgcaaggtgga
acatttacgatcactaatggtggagtctttggatctatgctttcaactccaattattaat
attccacaatctgcaatcttaggaatgcataatattgtagagagaccagtggccattaat
ggtcaggttgttattcaccctgtgatgtacttagcactatcttatgatcacagaattgta
gatggaaaagagtctgtaacattccttaaaacagttaaggaattaattgaagatccttca
agaatgttactagatatctaa

DBGET integrated database retrieval system