KEGG   Bacteriovorax marinus SJ: BMS_2421Help
Entry
BMS_2421          CDS       T01659                                 

Definition
putative inner membrane fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bmx  Bacteriovorax marinus SJ
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bmx01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bmx01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2433491..2434300)
Genome map
AA seq 269 aa AA seqDB search
MPSIFIAALVFACLCGISITVGYHRLFSHRTFEAAWPVKLFLLVFGAAAFQNSLLKWGSD
HRVHHKFCDTEKDPYNINRGFFWAHMGWVMFREPSKFKDQFPMSRDLLKDELVVWQHKYY
LPIAVLVGIVLPGLVGYLLGSALGGFAVIGFARIVAVHHSTFLINSLCHVLGAKTYSDEH
TAKDSPIMALFTFGEGYHNFHHTFQADYRNGVKWYHFDPSKWAIWSLSKVGMAKKLKRVP
ETTIRNARIKMEQKRFAASGAANLISNQG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgccatctatctttattgctgcactcgtctttgcgtgcctatgtggaatttctattact
gttggttaccacagacttttctctcaccgaacatttgaagcagcatggcctgttaaatta
tttcttcttgtttttggtgcagcggcttttcaaaactcacttctaaagtggggaagtgat
catagagttcaccataaattctgtgatacagaaaaagatccttacaatattaatagaggt
ttcttttgggcccacatgggttgggttatgtttagagagccttcaaaatttaaagatcaa
tttccgatgtctagggaccttctaaaagacgagttagtcgtttggcaacataagtactat
ctaccaattgctgttcttgttggcattgtccttcctggtcttgttggttacttacttggt
agtgctcttggtggatttgctgtgattggtttcgcaagaattgttgccgttcaccactca
acatttctaataaactctctatgccatgtacttggagcgaagacttactctgatgagcat
actgccaaagatagtccaatcatggcgctattcacttttggagagggttatcataatttt
caccacacatttcaagcagattatagaaacggagttaagtggtaccactttgatccaagt
aagtgggcgatctggtctttgtctaaagtaggcatggccaagaaactcaaaagagttcct
gagactacaattagaaatgctagaattaaaatggaacaaaagagatttgccgcttcagga
gcagcaaaccttataagtaatcagggataa

DBGET integrated database retrieval system