KEGG   Bacteriovorax marinus SJ: BMS_2465Help
Entry
BMS_2465          CDS       T01659                                 

Definition
putative sugar hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bmx  Bacteriovorax marinus SJ
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bmx00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bmx00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2470671..2471888
Genome map
AA seq 405 aa AA seqDB search
MLKILSILLLINSSWADYSLDEKIGQMILVGFRGSEVDANHQIIEDIHKYKIGSVILFDY
DVTLESRKRNIINRKQVKDLTKRIQRESEIPLLITVDQEGGLVQRLKQRHGFNKVLSPEK
VGKRNNLNFTYKESKKLAQDLESVGINLNFAPSADVNTNPDNPVIGKIERSYSSDPLKVS
NNVAAFIKSHHDLNIGTTIKHFPGHGSSRGDSHKGFVDVTDTWSEIELIPFKNMINQGNV
DILMSAHIFNGSLDPYYPGTLSKSILDDLLRTELKYDGVIISDDMNMSAITDHYGFERAI
ELAINAGIDILLYGNNLVYDKEIAKRVHTTIKKLLNEERVTIDQINKSFNRVMNLKKKLK
VIDKFKSVASTNKSIRKIANKTSILDSKERDEKREIFKKIKKMEE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaattctatcgattctacttcttattaactcaagctgggccgactatagctta
gatgaaaaaattgggcagatgattttagtgggctttcgcggaagtgaagtagatgctaat
caccaaattatagaagacattcataaatataaaataggatcagtaatcctctttgactat
gatgttaccttagagtcaagaaagagaaatattataaatagaaaacaagttaaggatctg
acaaagagaatacaaagagagagtgaaattccacttctcataacagtggatcaagaaggt
ggactagttcaaagacttaagcaacgtcatggatttaacaaagtgctctcaccagagaaa
gttggtaagagaaataatctcaatttcacttataaagagagtaagaagttagcacaagat
cttgaatcagtaggtattaatttaaattttgctcctagtgctgatgtaaatacaaaccca
gataaccctgtaataggaaaaatagaaagaagctactcaagcgatcctcttaaggttagt
aataacgttgccgcatttataaaatcacatcacgatttaaatattggaacaacaattaag
catttccctggtcacggatcttcaagaggagactcgcacaaaggctttgtggacgttact
gatacatggagtgagatcgaacttattccatttaaaaatatgataaatcagggcaatgtt
gacatacttatgtctgctcatattttcaatggttctcttgatccgtactacccgggaact
ttgtcaaaatctattttagacgatcttttaagaacagagctaaagtatgatggagtcatt
ataagtgatgatatgaatatgagtgctataacagatcactatggatttgaaagggccatc
gaactcgcgattaacgctggaatagatattctactctacgggaacaacctcgtttacgat
aaagaaattgccaaaagagttcacacaaccataaagaaactattgaatgaagagagagtt
accatcgatcaaatcaacaagtcatttaatagagtaatgaatcttaaaaagaaattaaaa
gtaattgataagtttaaaagtgtggcaagtactaataaatctattcgaaaaattgcaaat
aagacctcaatcctcgactctaaagaaagagacgagaagagagaaatctttaaaaaaatt
aagaagatggaagagtaa

DBGET integrated database retrieval system