KEGG   Bacteriovorax marinus: BMS_2465Help
Entry
BMS_2465          CDS       T01659                                 

Definition
putative sugar hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bmx  Bacteriovorax marinus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BMS_2465
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BMS_2465
Enzymes [BR:bmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BMS_2465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2470671..2471888
Genome map
AA seq 405 aa AA seqDB search
MLKILSILLLINSSWADYSLDEKIGQMILVGFRGSEVDANHQIIEDIHKYKIGSVILFDY
DVTLESRKRNIINRKQVKDLTKRIQRESEIPLLITVDQEGGLVQRLKQRHGFNKVLSPEK
VGKRNNLNFTYKESKKLAQDLESVGINLNFAPSADVNTNPDNPVIGKIERSYSSDPLKVS
NNVAAFIKSHHDLNIGTTIKHFPGHGSSRGDSHKGFVDVTDTWSEIELIPFKNMINQGNV
DILMSAHIFNGSLDPYYPGTLSKSILDDLLRTELKYDGVIISDDMNMSAITDHYGFERAI
ELAINAGIDILLYGNNLVYDKEIAKRVHTTIKKLLNEERVTIDQINKSFNRVMNLKKKLK
VIDKFKSVASTNKSIRKIANKTSILDSKERDEKREIFKKIKKMEE
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaattctatcgattctacttcttattaactcaagctgggccgactatagctta
gatgaaaaaattgggcagatgattttagtgggctttcgcggaagtgaagtagatgctaat
caccaaattatagaagacattcataaatataaaataggatcagtaatcctctttgactat
gatgttaccttagagtcaagaaagagaaatattataaatagaaaacaagttaaggatctg
acaaagagaatacaaagagagagtgaaattccacttctcataacagtggatcaagaaggt
ggactagttcaaagacttaagcaacgtcatggatttaacaaagtgctctcaccagagaaa
gttggtaagagaaataatctcaatttcacttataaagagagtaagaagttagcacaagat
cttgaatcagtaggtattaatttaaattttgctcctagtgctgatgtaaatacaaaccca
gataaccctgtaataggaaaaatagaaagaagctactcaagcgatcctcttaaggttagt
aataacgttgccgcatttataaaatcacatcacgatttaaatattggaacaacaattaag
catttccctggtcacggatcttcaagaggagactcgcacaaaggctttgtggacgttact
gatacatggagtgagatcgaacttattccatttaaaaatatgataaatcagggcaatgtt
gacatacttatgtctgctcatattttcaatggttctcttgatccgtactacccgggaact
ttgtcaaaatctattttagacgatcttttaagaacagagctaaagtatgatggagtcatt
ataagtgatgatatgaatatgagtgctataacagatcactatggatttgaaagggccatc
gaactcgcgattaacgctggaatagatattctactctacgggaacaacctcgtttacgat
aaagaaattgccaaaagagttcacacaaccataaagaaactattgaatgaagagagagtt
accatcgatcaaatcaacaagtcatttaatagagtaatgaatcttaaaaagaaattaaaa
gtaattgataagtttaaaagtgtggcaagtactaataaatctattcgaaaaattgcaaat
aagacctcaatcctcgactctaaagaaagagacgagaagagagaaatctttaaaaaaatt
aagaagatggaagagtaa

DBGET integrated database retrieval system