KEGG   Bacteriovorax marinus: BMS_2885Help
Entry
BMS_2885          CDS       T01659                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bmx  Bacteriovorax marinus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMS_2885 (tpiA)
   01230 Biosynthesis of amino acids
    BMS_2885 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMS_2885 (tpiA)
   00051 Fructose and mannose metabolism
    BMS_2885 (tpiA)
   00562 Inositol phosphate metabolism
    BMS_2885 (tpiA)
Enzymes [BR:bmx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BMS_2885 (tpiA)
Exosome [BR:bmx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BMS_2885 (tpiA)
  Exosomal proteins of bladder cancer cells
   BMS_2885 (tpiA)
  Exosomal proteins of melanoma cells
   BMS_2885 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2884736..2885476
Genome map
AA seq 246 aa AA seqDB search
MREIHIVGNWKMNQELEQVREFAKALEAMPSLNCQAWIAPQAIHVTTLLSATSKVKVGAQ
NCSNHNSGAFTGETSPKSLKDLGAHFVIIGHSERRAIFNEEDTLLNEKVLNALDNGLKTI
LCVGETLEQRESGEFKDVLATQLHSGLKGIKAADKENIIIAYEPVWAIGTGKVASPEQAA
EVHTFLREELSKVEALDSEQTPILYGGSVKPENIEGLLEKVDIDGALVGGASLKADSFME
LCKLSK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagagagatacatatcgttggaaattggaaaatgaatcaagagcttgaacaagttcgt
gaatttgccaaggcccttgaagcaatgccctctctcaattgccaggcatggattgctcca
caagcgattcacgttacaactctattgagtgcgacttctaaagttaaggttggtgcccag
aattgctctaaccacaactcaggagccttcactggagaaacaagtcctaaatcacttaaa
gaccttggtgcacactttgtcatcattggtcactctgagagaagggccatttttaacgaa
gaagacactcttttaaatgaaaaggtcctaaacgctctagataacggactcaagactatt
ctctgtgttggagaaactcttgagcaaagagagagtggagaatttaaagatgtcttggcc
actcaacttcactcaggactaaaaggtattaaagcagctgacaaagaaaatatcatcatt
gcatatgagccagtttgggccattgggacaggaaaagttgcttcaccagaacaagcggcg
gaagttcacactttcctcagagaggaattatctaaagttgaggccctagactctgagcaa
acacctattctctatggcggtagcgtaaagcctgaaaatattgaaggcttattagaaaaa
gtagatattgatggagctttggttggaggagcctctcttaaagccgatagtttcatggaa
ttatgtaaattaagtaaataa

DBGET integrated database retrieval system