KEGG   Bacteriovorax marinus SJ: BMS_3041Help
Entry
BMS_3041          CDS       T01659                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bmx  Bacteriovorax marinus SJ
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:bmx01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bmx01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmx00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bmx00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bmx00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bmx00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:bmx00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3048321..3049298
Genome map
AA seq 325 aa AA seqDB search
MSEIKRIGLLCSGGDSPGMNCAIRSVVRSAINANLEVYGIQRGFSGLLEGNIKELDVSSV
GNIIQHGGTILQTSRCPEFHEAETRKEAAHILKRKKIDALIVIGGNGSFNGAYALHTEHG
IPMVGIPGTIDNDISGTDYSIGFDTAVQTAIDAVDKIRDTASSHERTFIVEVMGRKSAAI
ALHVGVCTGAENVVLPSENVNVEEISNDIKRGIKRGKNSSIIIVAEGEKEGLSHRIQEQL
KADFELDSHVCILGHIQRGGNPSGQDRFIASGMGYLAIEELLKGNNSFVTAYRNGHVVAA
PFDECLEKKSEYLPQYINLVKTLSI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaataaaaagaattggccttttatgtagtggtggggatagtccaggtatgaac
tgcgctattcgttcagtagtgagatcggcgatcaatgcaaatcttgaagtttatggaatt
caaagaggattctccggactgcttgaaggaaatataaaagagctcgatgtttctagtgtt
gggaatattatccagcatgggggaactattttacaaacttctcgctgcccagagtttcac
gaagctgagacaagaaaagaagctgcccatattttaaagagaaagaagatagatgctctt
attgtcataggaggaaacggttcttttaacggagcttacgctcttcatacagagcatggc
attcctatggtggggattccaggaacaattgacaatgatatttctgggactgactactct
attggctttgataccgctgttcagacagctatcgatgctgtagataaaatccgcgatacg
gcctcttctcacgagagaactttcattgttgaagtgatgggaagaaagtctgccgctatc
gcacttcacgttggtgtatgtacgggtgcggaaaatgtggttcttccaagtgagaatgtt
aatgttgaagagatttcaaatgacattaaaagaggaataaaaagaggaaagaactcttca
attattattgttgccgaaggtgaaaaagaggggttaagccatagaatccaagaacagcta
aaggccgactttgaactcgactctcatgtttgtattcttggacatattcaaagagggggt
aacccttctggacaggatcgctttatagcttctggcatgggctatctggccattgaagaa
ttattaaaggggaataactcttttgtcacggcttacagaaatggtcacgttgtggcagcg
ccttttgatgaatgtcttgaaaagaaatctgagtacttacctcagtatataaatctagtt
aagaccctatcgatttag

DBGET integrated database retrieval system