KEGG   Bacteriovorax marinus: BMS_3041Help
Entry
BMS_3041          CDS       T01659                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bmx  Bacteriovorax marinus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMS_3041 (pfkA)
   01230 Biosynthesis of amino acids
    BMS_3041 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMS_3041 (pfkA)
   00030 Pentose phosphate pathway
    BMS_3041 (pfkA)
   00051 Fructose and mannose metabolism
    BMS_3041 (pfkA)
   00052 Galactose metabolism
    BMS_3041 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    BMS_3041 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    BMS_3041 (pfkA)
Enzymes [BR:bmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BMS_3041 (pfkA)
Protein phosphatases and associated proteins [BR:bmx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BMS_3041 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3048321..3049298
Genome map
AA seq 325 aa AA seqDB search
MSEIKRIGLLCSGGDSPGMNCAIRSVVRSAINANLEVYGIQRGFSGLLEGNIKELDVSSV
GNIIQHGGTILQTSRCPEFHEAETRKEAAHILKRKKIDALIVIGGNGSFNGAYALHTEHG
IPMVGIPGTIDNDISGTDYSIGFDTAVQTAIDAVDKIRDTASSHERTFIVEVMGRKSAAI
ALHVGVCTGAENVVLPSENVNVEEISNDIKRGIKRGKNSSIIIVAEGEKEGLSHRIQEQL
KADFELDSHVCILGHIQRGGNPSGQDRFIASGMGYLAIEELLKGNNSFVTAYRNGHVVAA
PFDECLEKKSEYLPQYINLVKTLSI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaataaaaagaattggccttttatgtagtggtggggatagtccaggtatgaac
tgcgctattcgttcagtagtgagatcggcgatcaatgcaaatcttgaagtttatggaatt
caaagaggattctccggactgcttgaaggaaatataaaagagctcgatgtttctagtgtt
gggaatattatccagcatgggggaactattttacaaacttctcgctgcccagagtttcac
gaagctgagacaagaaaagaagctgcccatattttaaagagaaagaagatagatgctctt
attgtcataggaggaaacggttcttttaacggagcttacgctcttcatacagagcatggc
attcctatggtggggattccaggaacaattgacaatgatatttctgggactgactactct
attggctttgataccgctgttcagacagctatcgatgctgtagataaaatccgcgatacg
gcctcttctcacgagagaactttcattgttgaagtgatgggaagaaagtctgccgctatc
gcacttcacgttggtgtatgtacgggtgcggaaaatgtggttcttccaagtgagaatgtt
aatgttgaagagatttcaaatgacattaaaagaggaataaaaagaggaaagaactcttca
attattattgttgccgaaggtgaaaaagaggggttaagccatagaatccaagaacagcta
aaggccgactttgaactcgactctcatgtttgtattcttggacatattcaaagagggggt
aacccttctggacaggatcgctttatagcttctggcatgggctatctggccattgaagaa
ttattaaaggggaataactcttttgtcacggcttacagaaatggtcacgttgtggcagcg
ccttttgatgaatgtcttgaaaagaaatctgagtacttacctcagtatataaatctagtt
aagaccctatcgatttag

DBGET integrated database retrieval system