KEGG   Bacteriovorax marinus SJ: BMS_3340Help
Entry
BMS_3340          CDS       T01659                                 

Gene name
ruvA
Definition
holliday junction DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bmx  Bacteriovorax marinus SJ
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bmx03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3326855..3327505)
Genome map
AA seq 216 aa AA seqDB search
MIGHLQGEVIFSDGVEAVVLTNSGIGYQVYINQVLPEGKSASIFISHVIKEASEELYGFK
TIREKKLFELLTSVKGVGPKSAFSLVGALGVDQIINSILFDDKKSLTKAPGIGNKAAAQM
ILDLQNKISKIKMYSNKSKGIQDVPAIQIPELSTSEQEESVHRESDNQELIIKDAIMACK
ELGFKEEKIIPLAQKILATNEISKPEQLVHLVLKEV
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgattggacacttacagggtgaagtaatttttagcgatggtgtagaagctgttgttctc
actaactcaggaattggatatcaagtttatatcaatcaagttctaccagaaggtaaaagt
gcttctatctttatttcacatgtcataaaagaagcaagtgaagagttatatggatttaaa
acgattcgcgaaaagaaattatttgaacttttaacaagtgttaaaggggttggtcctaag
tcggcctttagtttagtgggagctttaggtgttgatcaaattatcaactctattctcttt
gacgataagaagtctctgactaaagcaccgggtattggcaataaggccgcagctcaaatg
attttagacttacaaaataaaatttcaaaaataaaaatgtactcgaataagtcaaaggga
attcaagacgttcctgcaattcaaattcctgagctcagtacttctgagcaagaagagagt
gtccatagagaaagtgataatcaagagcttatcatcaaagacgctatcatggcatgtaag
gaactagggtttaaagaagagaagatcattcctttggcacaaaaaatattggctaccaat
gaaatttctaagccagagcaattagttcatcttgttttaaaagaagtatag

DBGET integrated database retrieval system