KEGG   Bacteriovorax marinus SJ: BMS_3395Help
Entry
BMS_3395          CDS       T01659                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bmx  Bacteriovorax marinus SJ
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bmx00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3377919..3378383
Genome map
AA seq 154 aa AA seqDB search
MSLILATGTNIGDRLQNLAQAKRQLSSAFSLQEESRIYQSAAVDYEEQPDFYNQVLVFSD
PKIEPNLLMTQVLELEAELGRTRDILRGPRIIDIDILFYNDIKSETDHLSLPHPRLFERS
FVIRPLMELEVFKELNKKYDFNTKFDTEAYPLKL
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttatccttgccaccggaactaatatcggtgatagacttcaaaatcttgcccaa
gcaaagagacagctctcctcagctttctctctccaagaagaaagtcgtatttaccaatcc
gctgctgtagactatgaagaacaacctgacttttacaatcaagttctcgtctttagtgat
cccaaaattgaacccaaccttcttatgactcaggtcctagaactagaagcagagctcggt
agaactagagatattcttcgtggacctagaattatagacattgatattctcttttataat
gacatcaagtctgagacagaccacctatcactgccacaccctcgtctctttgagcgaagt
tttgtgattaggcctttaatggagctagaagtttttaaagagttaaataaaaagtatgac
tttaatacaaagtttgacacagaggcttacccgcttaaactttaa

DBGET integrated database retrieval system