KEGG   Bacteriovorax marinus: BMS_3412Help
Entry
BMS_3412          CDS       T01659                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bmx  Bacteriovorax marinus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bmx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMS_3412 (gtaB)
   00052 Galactose metabolism
    BMS_3412 (gtaB)
   00500 Starch and sucrose metabolism
    BMS_3412 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BMS_3412 (gtaB)
Enzymes [BR:bmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BMS_3412 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3396998..3397885)
Genome map
AA seq 295 aa AA seqDB search
MNIRKAVIPVAGKGTRFLPATKQTPKEMLPIINIPMVHYCVMEAVESGIEQLIFVTSSGK
GSIENYFDRNLELENFLEQNGKLKELELIQNVSSMIEIITVRQKEQLGLGHAINCASPIV
GSETFSVILGDDIVRGQTPATKQLIDVSRDNGGKSVIGVMEVPETETYKYGIVDGEFLKD
SSTTLKMNAMIEKPKPAEAPTNLATPGRYILSGDIFECLREIPRGVGGEYQLTDAINMLA
NKDEVYAHKFIGDRFDTGCIEGYLNATVEFALRDESTKDLMLNIIKEKIKTYGIK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaatattagaaaggccgtcatccctgttgcgggtaaaggaacaaggtttttaccggca
acaaaacaaacacctaaagagatgttgccaataatcaatattccaatggttcattactgt
gtaatggaagcagttgagtcaggtattgagcaattaatttttgtgacttcttctggaaag
ggttctatcgagaattattttgatagaaacttggaattagagaactttcttgagcaaaat
ggtaagttaaaagagttagagcttattcaaaatgtaagttctatgattgaaattataact
gtaagacaaaaagagcagttaggtcttggtcacgcgattaattgtgcttcgccaattgtt
ggaagtgagactttttcagttatccttggcgatgacatcgtaagagggcaaacaccagcg
actaaacaattaattgatgtctctagagacaatggtggcaaatccgtaattggagttatg
gaagttccggaaactgaaacatataagtatggaatagtggacggagaattccttaaagat
agttcaactactttgaaaatgaatgctatgattgaaaagccaaagcctgctgaggcacct
acaaatttagcaacaccaggtagatatattctctcgggagatatttttgagtgcttgaga
gaaataccaagaggagttggtggggaatatcagcttacagatgctatcaatatgctggct
aataaagatgaggtttatgctcataagtttattggagatagatttgatacaggctgtatt
gaaggttacctaaatgcaacggttgaatttgctcttagggatgaatctacaaaagactta
atgttaaatattatcaaagagaagattaaaacttacgggataaaataa

DBGET integrated database retrieval system