KEGG   Brugia malayi (filaria): Bm1_00405Help
Entry
Bm1_00405         CDS       T01050                                 

Definition
LP10852p
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
bmy  Brugia malayi (filaria)
Brite
Ribosome [BR:bmy03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    Bm1_00405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 261 aa AA seqDB search
MLHRHIHLLFQRSNFLSLNKNYRLIGCNYHNSSQFWCASKVEEGSSSEENERVEEAVGYA
YNTVEKKKGLYKPKHTLEEQIAYMNSKVYADTYKGMPVYHSYRRNFKGQAIFMPKPRMFC
IDKEGRFKVNHACPICRDEYLFFDYRNPALILQFLFDQTDRILPLKKLGLCFDQYAQLRA
QLLKAKEHGFIKFAVPFQNFNYKKWYPWWDKEDDHVYVRREVPVDEIHKQPLVNFPVHNR
DYNNDWDQYWLRYDEFIQRSK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcttcataggcatattcacttgctattccagagatcgaactttctatcactgaataag
aattatcgactgattggttgtaattatcataattcatcgcagttctggtgtgcttcaaaa
gtggaagaaggaagttcatcggaagagaatgaaagagtagaagaagctgttggttatgcc
tataatactgtagaaaagaaaaaaggtctttataagccaaaacatacattagaggaacaa
atagcgtatatgaatagtaaagtatatgcagatacgtataaaggaatgccagtttatcat
tcctacagacgaaatttcaagggacaagctatttttatgccaaagcctcggatgttttgt
attgacaaagaaggaaggttcaaagtaaatcatgcatgcccaatctgtcgagatgaatat
ttattctttgattatcggaatcctgctttaattctacaatttctttttgaccagactgat
cgtatattacctctcaaaaagttgggtctatgttttgatcaatatgcgcagcttcgggca
caattgttaaaagcaaaggagcatggtttcattaagttcgctgtaccatttcaaaatttc
aactataagaagtggtacccatggtgggataaagaggatgaccatgtatatgttcgtcgc
gaagtaccggtggatgaaattcataaacagcctctggtaaatttcccagttcataatcgt
gattacaataatgattgggatcaatactggttacggtatgatgaatttatacaacgatcc
aaataa

DBGET integrated database retrieval system