KEGG   Brugia malayi (filaria): Bm1_00475Help
Entry
Bm1_00475         CDS       T01050                                 

Definition
PH domain containing protein
Orthology
K16172  
insulin receptor substrate 1
Organism
bmy  Brugia malayi (filaria)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:bmy04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:bmy04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 976 aa AA seqDB search
MDKKRTSSSVEEETGVLKSGYVTAAFSPVKTKRMYYAVLGHRALELHENEKKSQRKNRHP
RHLIDLSTCFNINRHFDGRLKYCIAIMTPDETLVLRAETDVLSDEWYDMLMSALIPARAL
HLGRPVLANEFFECAWDVTMVEHPKFRKSVKSSEKLINLCTKDPSLLGPHRLCFYHHTII
LCRRGIEPAPSDALSQSGIPPFKVTDFVEFPRQYMASFGCQERYFFMVMGRSSPSGSGEL
WALCDCEEVAADVHNKLNKIIEEECEKKKKMPNGPLLHLTSTYHSHRDRLHTHSGLRRTG
TTMSKKLTPDEMSLKERRAQIRGYKWAADSIQERAQEDTLSPNVPSFLWFDSTTTARGNC
LKNSRSGQNSLVRKIDRTRSFETKVSLSSSSAVPRAGNENNCKTMNEKNSKGYFPAELSL
ESLEWSNLFRNHPSFASSSATEETEDSGGTLRTDLEETNPSKTSVERQIKATIERTHPSI
LKQQFLPHSESRKVISTTSGYPECDERADGTSCSVAGSTSTNDDFLQTTPGEMSEDASGD
NLEYAPMEMNSWSSGSASHLGLSIGEPQFNFEEVRSYVSDSSDSCYSSMVANGAPRAYSF
GTSHIVHQQPRRSGRKLMHPEHGSPAPDSLRNSGTLPQNEDVHHSNKPSPSTSASQEDAR
KRAFSLGSSKSWFQKPFRKLSRDFISRAHRLSNTSQTSSTSSTGLSLVHSPNSSFLPSTP
QAFIAPDPYPTSRVRSGSIGSGLSTPYSKRHLSNDPTGDHVPVDFGGGGLSLGKSASGSL
HSVDSPSRSRTSSFGCGQRCYGLRDTSDVVMHATDTESECASALSSRCTYERRREQLNSS
VCIPNEFDETDDYVIRDPANASDIHISSSRVSHEGQLCANSYPDSRSSQIFETIQESLSG
RSSPTKDTDSIGSYEEQEASDKTDRKSDNSKSIEKKICKEDSNDGESEQEQKKTLCSGRD
LEFVPVDVSFDFMSIQ
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaaacgaacctcaagttcagtggaagaagaaacaggtgtgttgaaatcgggc
tacgttacagctgcattttcgcccgtcaaaacaaaaaggatgtattacgcagtattgggt
catcgagcacttgaattgcatgaaaatgaaaagaaatctcaaaggaagaacagacatccg
cgacatctgattgatctctccacgtgtttcaacatcaatcggcattttgatggtcgattg
aaatattgtatagcaattatgacacctgatgaaacactcgttttgcgagcagaaacagat
gtgttgagtgatgaatggtacgatatgttaatgtctgcattgatacctgcacgagcttta
catcttggacggcccgttctcgctaacgaattttttgaatgtgcttgggatgtaacgatg
gttgaacatccaaagttccgaaaatcagttaaatcttcggagaaattgattaatttatgt
acaaaagacccgtcattactcgggccacatcgattatgtttctatcatcatacgataatt
ttatgtcgacgaggtattgagccagcaccttcagatgctttatcacagtcaggcattcca
ccgttcaaagtaaccgactttgtggaatttcctcgacagtacatggctagttttggttgc
caggagagatatttttttatggtaatgggccgctcatcaccatctggttccggtgaatta
tgggcattgtgtgattgtgaagaagtagctgcagatgtacacaacaaattaaataaaatt
attgaagaggaatgtgagaaaaagaaaaaaatgccgaatggaccgttactgcatttgact
tctacgtatcattctcatcgtgaccgacttcatacacacagtggacttcgaagaacagga
accacaatgtcaaaaaaattgactcctgatgaaatgtcactgaaagaacggcgagcccaa
atacgtggttacaaatgggctgcagattcaattcaggaaagagcacaggaagacacactc
tcgcccaatgttccttcctttctgtggtttgattcgactaccactgctagagggaactgt
ttgaagaattcacgatctgggcagaattcgttagttaggaaaattgatcggacgcgaagt
tttgaaacgaaagtatcactctcctcatcatcagcagttcctcgagcaggaaatgagaat
aactgcaaaacaatgaatgagaagaatagtaagggatatttcccagcagaactgtcatta
gaaagtttggagtggtcgaatctttttcgaaatcatccctcgtttgcgtcatcgtcagct
acggaagaaactgaagacagtggtggcacattacggaccgatttggaagaaacaaatcct
tctaaaacatccgttgagcgacagattaaagcaaccatcgaacgaacgcatccgtccata
ttaaagcagcagttcctgcctcattcggaatctcgaaaagttatttcgacaaccagtgga
tatcccgaatgtgatgaacgagccgatggaacatcatgttcagttgccggaagtacaagt
accaatgatgatttcttgcagacaacacctggcgaaatgtcagaggatgcatctggagat
aatttggagtatgctccaatggaaatgaattcatggtcatcgggaagtgcatcacatctt
ggtttgtcaataggagagccacaattcaattttgaggaagtgcgatcatatgtatcggat
agtagtgatagttgctattcttcaatggtagcaaacggtgcaccgcgagcatattctttt
ggtacgtcacatattgtgcatcagcaaccgcggcgttcaggaagaaaactgatgcatcct
gaacatggttcaccggcaccggattccttgcgcaatagtggtaccttaccgcaaaatgaa
gatgtgcatcattcgaataagccatcaccgtcgacttctgcatcgcaagaagatgctcga
aagagggctttttctttaggcagtagcaaatcgtggtttcagaaaccatttcgaaagcta
tctcgagattttatatcacgtgcacatcgtttatcgaatacatcgcaaacatcatcaaca
agttcaaccggtttatcactcgttcattcgccgaattcttcctttttaccctcaacacct
caagcgttcatagctcctgatccatatccaacttctcgtgttcgatctggaagcataggg
tcaggactttcaaccccatattcgaaacggcatctgagtaacgatcctacaggcgatcat
gttccagtggattttggtggcggtggcttatcacttgggaaatcagcaagtggttcactg
catagtgttgatagtccgtcaagatcaagaacttcatcgtttggttgtggacaacgatgt
tatggattacgcgatacaagcgatgtcgttatgcatgcaacggatacagaaagcgagtgt
gcttcagcactttcatcacgatgtacatatgaacgacgtagggagcaactcaatagctca
gtatgcataccaaatgaatttgatgaaacagacgactatgtcataagagatccagcaaat
gcgtcggatattcatattagttcatcacgagttagtcatgaaggacaattgtgtgctaat
agttatccagattctcgtagttcacaaatttttgaaacgatacaagaaagtttatcagga
cgatcatctcctacaaaagatactgattcgattgggagttacgaagagcaggaagccagc
gataaaacggataggaagtctgataacagtaaatccatcgaaaagaaaatttgtaaggaa
gatagtaatgatggtgaaagtgagcaagaacagaaaaaaacattgtgttctggtcgtgat
ttagaatttgttcctgtggatgtaagcttcgattttatgtcgattcaataa

DBGET integrated database retrieval system