KEGG   Brugia malayi (filaria): Bm1_00930Help
Entry
Bm1_00930         CDS       T01050                                 

Definition
Hypothetical UPF0028 protein ZK370.4 in chromosome III, putative
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
bmy  Brugia malayi (filaria)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bmy00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1248 aa AA seqDB search
MHFQKSYYLSLSSDSSEHLLFSRRTPIRRRHSNVGPFQLARAAKDFIVHGSSAKFQRQLS
EMTKRKLPKPPSQFFEPSEVPIIPQNEKPEVYYILHNIKMLELPSEWYAQWKGLIVEEYK
ENDYLIRPGDKDNHIVVVLEGVIAVFITHTEGKELMVRKITVGDSFFSLLSILDVLMNHE
IIFRNISVRALTKCRIARCSTNSFRDSFIKNPEFWVRPIQIVLTRLLHVTLTTLHQYLGL
SIELVKKRPDEKRNMDERHRHLSGITSSNRLQGKIRSRTHRLNSIDDSKEYLATAQRWFA
EVLHLGVSPEAIAILAGRVTIENVPEKHLIVEQNSEDELLIMVLSGFLSISQEPIDGEDE
NIDEEQFFIYPRELIGGLQLLTGEPWFVTVRSHTCAIYATISKKDFFELVDIHPEIVLPV
AHSVIRRLSSFVRHVDFAVDWVLLDSGQAVYRSGDVADSIFVLLSGRLRSVENKKVIEEF
GRGDVLGMIEVLQRVPRATTVLAIRFSQLARLPEGLLNFIKIKFPQVGFRLVHLLGQYYT
SSIQSTSTFRCGYKDGLSMTTGDPQSHIKNLHTIAVVAATPDVPLTAFTCELYHALTANL
RVLRLSSQKIAELLDVSVLEKQADFRLMHWLNLQEDTYPLIIYECDTSATSWTRRCLRQA
DAILFVANGEQKPFQQSLMDDYLNMNEDGIRTNKELILLWDEKTVEPQGTIEWLKGSWFS
GHHHIRIHKRMVQWDLKKVSESDIVSFYEQNIYGGKVDSGSDFSRLARILTGNAIGVVLG
GGGARGASHVGVLRAIQEHGIPIDMIGGTSIGSMIGGLYAQEVEDLEQRAKSWFMMMASI
WPKIWDLTYAHSAMFTGAGFNHGLQDLFSDSLIEDLWIPYFCISTDISNSEMRIHRTGPL
WAYCRASMSLAGYLPPLCDPIDGHLLLDGGYVNNLPADVMQSMGAKIVIAVDVGSAAETN
LYNYGDSLSGFWVLLKKLNPFAEPIKVLNMEEIQSRLAYVSCMQQLQSVKNAGYCQYVRP
PIEEFKTLDFYRYDEIRDLGYKHGVKQFGELVKTNEDLKNVIDAEKLRSLKRRYWRREPS
KLAMYDRGRASSFTNLAAQVSRVPKVREKNSLNDDEVAEDELSDVWWDEEEEEQEPDVHS
QPAYNSEDVESIEAGYISEPCTTYQSKYTFSSEDEVSTDNNRKRKTTLSEVNQNGEEKIE
MQKVPSEKGPTVRFGLSKSLSDDKLQESQDMVLNSDRSATKIDNNAMQ
NT seq 3747 nt NT seq  +upstreamnt  +downstreamnt
atgcattttcaaaaatcatattatctatcattatcatcggatagtagcgaacatcttctt
ttctcacgaagaacaccaataaggcgtcgacattccaatgttggtccatttcagcttgct
cgtgctgccaaagactttattgttcatggtagtagcgcaaaattccagcgacagctttcg
gaaatgacaaaaaggaaattrcctaaaccgccatctcaattttttgagccctcagaagtt
ccaattattccacaaaatgagaaaccagaagtatattatattttacacaatatcaaaatg
ttrgaattaccgtcggaatggtatgcacaatggaaaggtttgatcgtagaagaatacaag
gaaaatgattatctgatcagacctggcgataaagataatcacattgttgttgttttagaa
ggggtcattgctgtctttataacgcatactgaaggaaaagaacttatggttcggaaaatt
acagttggtgatagcttcttcagtcttctatcaattttggatgttttaatgaaccatgaa
ataattttccggaatatatcagtaagagctttgacgaaatgccgaattgccagatgtagc
acgaatagttttcgggattcattcattaagaatcctgaattttgggttcgaccaattcaa
attgtcttaacacgattgctacatgttactttaacaacacttcatcaatatctcggttta
agtatcgaattagtgaaaaagcgtcctgatgaaaagcgtaatatggatgagcgtcatcga
catctatctggaattacttcctcaaatcgtctgcaaggcaaaatacgatcacgtactcat
cgtctaaatagcattgatgattcgaaggaatatttggcgacagcacagcgatggtttgct
gaagtactccatctaggtgttagtcctgaagcgatagcaattttggcaggtcgtgtaacc
attgaaaatgtccccgagaaacatcttattgtagagcaaaattctgaagatgaattatta
attatggttctcagtggttttctaagtatttcacaggagccaattgatggagaagatgag
aatatagatgaagagcagtttttcatatatccacgcgaacttatcggcggattacaatta
cttaccggtgaaccatggtttgttacggttcgatctcatacgtgtgcaatatacgcaact
atttcgaaaaaagatttctttgaattggttgatatccatccggaaattgtattgccagtc
gcacattcagttattcgacgactaagttctttcgttcgacatgtagattttgcagttgat
tgggtcctgcttgattccggacaggctgtatacagaagtggtgatgtagctgactcaata
tttgtccttttaagtggacgacttcgatctgtagaaaacaaaaaagtaatcgaagagttt
ggacgaggtgatgttttgggaatgattgaggttctgcagcgagtaccgcgagccactact
gtccttgcaattcgtttttcacaattagcacgacttcctgaaggccttttgaattttatt
aaaataaagttcccacaggttggatttcgtcttgtccatttgctgggtcagtattatact
tcatcgatacaaagtacatctacatttagatgcgggtacaaggatggcctttcaatgaca
acaggcgacccacagagtcatattaaaaatttgcatactattgctgtggtagctgcaaca
cccgacgtgccattaactgcatttacttgtgagctatatcacgcccttacagcaaatttg
cgagttctgcgattgagcagtcagaaaatagccgaactactggatgttagtgtgctagaa
aagcaagcagattttcgccttatgcattggcttaatttgcaagaagatacctatccgtta
attatctatgaatgtgacacaagcgctacaagttggacacgacgttgtcttcgtcaagca
gatgcaatattattcgttgctaatggtgaacagaaaccatttcaacaatcattgatggat
gattatttgaatatgaatgaagatggtattcgaacaaacaaggaattgatccttctctgg
gatgaaaaaactgtagaaccacaaggaactattgaatggttgaaagggagttggttttcg
ggtcatcatcatatccgcattcataaacggatggtacagtgggatttgaagaaggtatct
gaatccgacattgtatccttttatgagcaaaacatttatggtggaaaggttgacagtggg
tcagatttttcaagactagctcgaatactgactggaaatgcaattggtgttgtgctcggt
ggaggtggtgcaagaggtgcatctcatgttggtgttctgcgtgcaatacaggaacacggt
attccaattgacatgataggaggaacatcaattggatctatgatcggtggcttatacgct
caagaggttgaagatttagaacagagagcaaaaagttggttcatgatgatggcttctatc
tggccaaaaatatgggatttaacatatgcccattcggcgatgtttactggtgctggtttt
aatcatggtcttcaggatttattctcggattcattaattgaagatttgtggataccttac
ttttgcataagcactgacataagtaattcggaaatgcggatacatcgaactggtccatta
tgggcttattgtcgagcatcaatgtctttggcaggttatcttcctccattgtgtgatcca
atagatggtcatttgttgttagatggtggttatgtcaacaatttaccagcagatgttatg
caatctatgggtgctaaaatagtaatcgcggtagatgttggttctgctgccgaaacgaat
ttatacaactacggtgattcattgagcggattttgggtattgctgaaaaagttaaatcca
tttgctgaaccaatcaaagttttgaatatggaagaaatacaaagtcgtctggcgtatgtc
tcttgtatgcaacagctacagtcagtgaagaatgcaggatattgtcagtatgtacgacca
cctatcgaagaatttaaaaccttagatttttatagatacgatgaaatacgagatctcggc
tataaacatggcgtaaagcagttcggagaattagtgaagacaaatgaagatttgaaaaat
gttatcgatgctgagaaattacgttcactgaaacgacgttattggcgtcgggaaccttca
aaattagctatgtatgaccgtggccgtgcttcatcattcactaatcttgccgctcaggtg
tcaagagttccaaaagtacgcgaaaagaatagcttaaatgatgatgaagttgcggaagat
gaactatctgatgtttggtgggatgaggaggaggaagagcaagaaccagatgtgcactca
caaccagcctataattctgaggatgttgaatctattgaggcaggttacatcagtgaaccc
tgcactacttatcagagtaaatacacattcagtagtgaagatgaagtaagcactgataat
aatcgaaaacgaaagaccactttatctgaagtgaatcaaaatggtgaagagaagattgaa
atgcaaaaggtgccatcagaaaaaggacctacggtacgatttggattgtcaaaatcacta
tctgatgataagctgcaagaaagtcaagatatggtgcttaattctgatcgatctgcaacg
aaaattgataataacgcaatgcaataa

DBGET integrated database retrieval system