KEGG   Brugia malayi (filaria): Bm1_02220Help
Entry
Bm1_02220         CDS       T01050                                 

Definition
Ubiquitin carboxyl-terminal hydrolase family protein
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
bmy  Brugia malayi (filaria)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 731 aa AA seqDB search
MNAATGRGFNSHNDVWQPSVVDIGMSESQIYPRGLTGLTNLGNTCYMNAAIQALSNCPPF
SDFFRSLDSIASFASKVLDNNAEPPISSSFRCLLQALWSEERNRCINPQLFLAQIRNQYP
QFRGPAQQDAQEFIRCLLDILHRELRQPVFAWEYRNITRSCNIQTEEESISGFIGSRYVP
SRSSSSASDDDERYETADSGWSSDGEVPTASKAANKHSEPITNNRLTHTSDHSVNQQESA
VTGPRSRQSKSPIYYRSLVTEVFDGRLSSVVKCLTCHHLSETCETFQEEVDNNENVSWQW
PWWLGGSLFRSIYHYLFGDLVSLNDALAAFFLPDDLCGENMYSCEKCSKLRNGVKICKII
DPPEILCIHLKRFRHDLSDSVKVRSKVTFPVHDLDLTPFIANFEKSKEPVLYDLVAFITH
YGANAESGHYIAYCKNEVDDNWYEFDDNVVTRLEIGDILSKEAYVLFYQRQSSQSMDDIR
IHVRQMLEENDKIKVSLHRYISREWLHRFSTFSNPGPITNYDFLCQHSQILPRRAASLTD
YYATISSSLWDFLYEKFGGGPSSSELHYCLTCQNEFQVMKRKREIELRAFLTLEGQLKRL
KNNIPALTYGYYMPPNVIAKAWIDKWKAFVEENEFEPPGSIDNNIILVRSSNTCDAKLHL
RPSQYVELPREAWLFLQSIYGGGPELLCIPEDHPSLESLQKLIAKVNEKIVETLESLKRR
NADGIPLSSHS
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagcaactggacgtggattcaattctcacaacgatgtttggcagccatctgtg
gtagatattggaatgagcgaaagtcaaatttatcctcgtggtttgacaggactaacaaat
ttggggaacacgtgctatatgaatgcagccattcaggcactctcaaattgtcctcctttt
tccgacttcttccgttcacttgattccattgcttcttttgcttcaaaagtgttagataat
aatgctgaaccgcctatttcgagttcatttcggtgtctactgcaggcactttggtctgaa
gaacggaatcgctgcattaatccacaactttttcttgcccaaattcgcaatcagtaccca
caatttcgtggcccagcgcaacaggatgctcaggaattcatcaggtgccttctagatata
ttacatcgcgaattacgccagcctgtttttgcttgggagtatcggaatattacacgtagc
tgcaatatacaaacggaggaagaaagcatctctggtttcatagggagcagatatgttcca
tcgcgttctagtagcagcgcgtctgatgacgatgaaagatatgaaactgctgatagtggt
tggagctctgatggagaggtgcctacagcttcgaaagcagcaaataagcattccgagcct
ataactaacaatcgactaacacatacttcagaccattccgtaaatcagcaggagtcagca
gtaacgggtccacgaagcagacaatctaaatcacctatttattatcgaagtttggtaacg
gaagtctttgatgggcgtttaagtagtgttgtgaaatgtcttacatgccatcatctttca
gaaacttgtgaaacattccaggaagaagttgataacaatgagaacgtttcttggcagtgg
ccatggtggcttggaggaagcttgtttcgttcaatatatcattatctatttggggattta
gtttctctaaatgatgcacttgcagcgttctttttgcctgatgatctttgtggagaaaat
atgtattcttgcgagaaatgttccaaattgcggaacggtgtcaaaatttgcaaaatcatc
gatccgccagaaattttatgcatacatttaaaacggtttcggcacgatctatcggattca
gttaaagtacgaagtaaggtaacatttccagtacatgatctggatttaacaccatttatt
gccaatttcgaaaaaagcaaagaaccagtgctctatgatttagttgcattcatcacacat
tatggtgcaaatgccgagagcgggcattatattgcttattgcaagaatgaagtggatgat
aattggtacgaatttgatgacaatgtggtaactcgattggaaatcggtgatatcttgagt
aaagaagcttatgtactattttatcaacgacagtcatctcagagtatggacgacattcga
attcatgtgagacagatgcttgaggaaaatgataaaataaaggtctcattacatcgctac
atttctcgagaatggttgcatcgtttctcaacgttttcaaatcctggacccattacaaat
tatgatttcctttgtcaacactcgcaaatcctcccacgtagagcagcaagtctcactgat
tattatgcaaccataagcagttcactgtgggattttctttatgaaaaatttggtggtgga
ccttcaagttccgagttgcactattgtttgacctgccaaaatgaatttcaagtaatgaaa
cgtaaacgggaaattgagctaagggcattcttaacattggagggacagttgaagcgattg
aaaaataatataccagctcttacttatggttattacatgccaccgaatgttatcgcgaaa
gcttggattgacaaatggaaggcatttgttgaagaaaatgaatttgagccaccgggatcc
attgataataatatcatactggttcgtagtagtaatacgtgtgatgcaaaactgcattta
cggccttcacagtatgtggagttacctcgtgaagcttggttatttctccaatcaatatac
ggcggtggacctgaattgctatgcattccggaggatcatccatctttggaaagtctgcaa
aaattgattgcaaaagtaaacgaaaagattgtggaaactttggaaagtttgaaaagaaga
aatgcagatggtataccgttgtcgtcacattcatga

DBGET integrated database retrieval system