KEGG   Brugia malayi (filaria): Bm1_02510Help
Entry
Bm1_02510         CDS       T01050                                 

Definition
histone H2B 2
Orthology
K11252  
histone H2B
Organism
bmy  Brugia malayi (filaria)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 122 aa AA seqDB search
MPPKPSAKGAKKAAKSHKPRSGDKKRRSRRKESYSAYIYRVLKQVHPDTGISSKAMSIMN
SFVNDVFERIAAEASRLAHYNKRSTISSREIQTAVRLILPGELAKHAVSEGTKAVTKYTS
SK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgccaccgaagccgtcagctaaaggagcaaagaaagcagcgaagtctcataagccgcgt
agtggcgataagaaacgacggagtcgacgaaaggagtcttactcagcatacatctatcgg
gtcctgaagcaggtacatcctgatacgggcatctcatcgaaggctatgtcgattatgaac
tcattcgtaaacgacgtcttcgaacgtattgctgcggaagctagtcgcttggctcattat
aataarcgttcaacgatctcatcccgtgaaattcagacagctgttcgacttattctccca
ggtgaattggctaagcatgctgtttcggaaggtacaaaggcagttacgaagtacactagc
tcgaagtga

DBGET integrated database retrieval system