KEGG   Brugia malayi (filaria): Bm1_02775Help
Entry
Bm1_02775         CDS       T01050                                 

Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bmy  Brugia malayi (filaria)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bm1_02775
Enzymes [BR:bmy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Bm1_02775
Exosome [BR:bmy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bm1_02775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 648 aa AA seqDB search
MSSSSSRPPQLDNLLKLDGYLWNYQTEICRRYGVFLDYSKRIEECGGWETFTTAYREYGV
VVMRDNSVRCLEWAPGAEALSLVGDFNDWNTESHPYKKLEYGKWELIIPADKDGNCPIKH
GSIIKVAVKKNGVFHFKLSPWAHYVTRPKETTVYHMPFYNPPESECYRFKHPRPSKPESL
RIYEAHVGISSSEGKVNTYKNFANDVIPRIKKQGYNTIQLMAIMEHVYYASFGYQVTSFF
APSSRCGTPEDLKYLVDKAHEAGILILLDVVHSHASKNVEDGLNEWDGTQNKYGFDGFRF
DGVTSMLYHSHGIADALDGGYDMYFGLNVDTDSLVYLMLANSFLHRKFPNVVTIAEEVSG
MPALCRPVEEGGQGFDYRLAMAAPDLWIKLLKHFSDEDWDISNLVFTLENRRYAEKHIAY
AESHDQALVGDKTIAFWLMDKEMYDFMSDTSPLTPIIERGIALHKMIRLITYGLGGEAWL
NFIGNEFGHPEWLDFPRLGNNESFYYCRRQWNLVDDELLRYKYLNNFDRAMNQLEQKHHF
LSRGPAYTSWKHQDDKVIAFERAGLLFIFNFHTYKSFSDYKIGIEVAGEYALALSTDDSE
FGGFNRLDKNQHYFTFPEGYAGRRNHLCVYVPCRVAIVLERVGEKRIS
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcagcagtagcagacctcctcaacttgacaatttgttgaagttggatggatac
ctatggaattatcagactgaaatatgtcgcagatatggagttttccttgattattcgaag
agaattgaagagtgtggtggatgggaaacattcacaacagcttatcgagaatatggtgtt
gtggtgatgagggataattcagttcgttgtttggaatgggcaccaggagcagaagcttta
tcattggtgggagattttaacgattggaacactgaatctcatccatacaagaaactagaa
tatggcaaatgggaattaattattccagctgataaagatggtaattgtccgattaaacat
ggatcgattatcaaggtcgcagtaaaaaaaaatggcgtatttcattttaaactgtctcct
tgggcacactatgttacacggccgaaagaaacaacagtttatcacatgcccttctataac
ccacctgaatcggagtgttatcgttttaaacatccaagaccatcaaaacctgaatcatta
cggatttatgaagcgcatgttggaatatctagttcggaaggaaaagtcaatacctacaag
aattttgcaaatgatgttatcccgagaatcaagaaacaaggttataatactattcagcta
atggctattatggaacacgtttactatgctagtttcggctatcaagtcactagtttcttc
gcaccatcaagccgttgcggaacgccagaagacctgaaatatcttgtggataaagcacac
gaagcgggtattctaatcttacttgatgtggtacattcgcatgcttcaaagaatgtagaa
gatggattgaatgaatgggatggtactcagaataaatacggctttgatggattccgattt
gatggtgtaacatcgatgttataccattctcatggaattgccgatgcattagatggcggt
tacgatatgtatttcggtctgaatgttgatactgactcacttgtttatttaatgcttgcg
aattcatttttgcaccgtaaatttcccaatgtcgtgacaattgctgaagaagtaagtggc
atgccagccttatgtcgaccagttgaagaaggtggacaaggtttcgattatcgcttagcg
atggcagcaccggatttgtggattaaacttctcaaacatttctctgatgaagactgggat
atttctaatttggtatttacactggaaaatagaagatacgctgagaagcatattgcatat
gctgaatcacacgatcaggctcttgttggtgataagacgattgcattttggttgatggat
aaagaaatgtacgatttcatgtctgatacatcaccattaactcctataattgagcgtggt
atagcactgcataaaatgattcgtcttatcacatatggattaggtggcgaagcatggttg
aatttcattggtaacgaattcggtcacccagaatggcttgattttccacgtttgggtaac
aacgagtcattttattactgccgtaggcaatggaatttagtagatgatgagcttcttcga
tacaaatacttgaataattttgatcgtgctatgaaccaattggaacagaaacatcatttc
ttatcacgtgggccggcatatacttcgtggaagcatcaggatgataaagttatagcattc
gaacgtgctggccttctttttattttcaatttccatacgtacaagagtttctcggattac
aaaattggtatcgaagtggcaggagaatatgcactggcattgagtactgatgactctgaa
tttggtggttttaatcgattggataaaaatcagcattattttactttcccggaaggttat
gctggtcgacgaaatcatctttgcgtatatgttccatgccgtgttgctattgttttggaa
agagtaggcgaaaagcgtatttcttga

DBGET integrated database retrieval system