KEGG   Brugia malayi (filaria): Bm1_04795Help
Entry
Bm1_04795         CDS       T01050                                 

Definition
Gem-associated protein 7
Orthology
K13135  
gem associated protein 7
Organism
bmy  Brugia malayi (filaria)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Bm1_04795
Spliceosome [BR:bmy03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    Bm1_04795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 109 aa AA seqDB search
MTKDEIKDSACDQLIKQGETSEQEQRAELRERFLRLMSFLGGKQIELDMHERTQVTGKFC
AVKADQTHYIVDALITPIGLINHAILRMNDTIMISTNDLSELSDSKIPI
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagatgaaattaaagactccgcttgtgatcagttaatcaaacaaggtgaaact
tcagaacaagagcaaagagcagaattgagagaacgcttcttgaggttgatgtctttttta
ggaggcaaacagatagagctcgatatgcacgaacgtactcaagtgacaggtaaattttgt
gctgtaaaggcagatcaaacccattacatcgttgatgcactgattacaccaatcggtctg
atcaatcatgctattttgaggatgaatgatacaatcatgatctcaaccaatgatctaagt
gaactgtcagattccaaaattcccatttag

DBGET integrated database retrieval system