KEGG   Brugia malayi (filaria): Bm1_06480Help
Entry
Bm1_06480         CDS       T01050                                 

Definition
OTU-like cysteine protease family protein
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.4.19.12]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Bm1_06480
Peptidases [BR:bmy01002]
 Cysteine Peptidases
  Family C85: DUBA deubiquitinylating enzyme
   Bm1_06480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 377 aa AA seqDB search
MTILPKPKKVIKSAERHSSQQTGTSSSKSSHSLGASSPETNKQPRQSTPEENPGAPIINS
DDEDGSGFKDDNLEAWFEERLRCVRGLVIKPVRGDGACLFRAVADQIYGDEEMHDDVRRL
CMDYMEKNSDHFSQFVTEDFHDYITRKRRRDAHGNHVELQAISEMFSRPIEIYEYCTEPR
NISSSRLDSSPSAEPNPPIRLSYHGAIHYNSVIDPTKATIGVGLGLPEYSPGAADRSLLQ
EAMQKSEVQMIEDAMLHDKIKMTDFERTEQDISEQIARQSYLDYLKSLSKTGNAEMRETA
YAVSEPGCSHANVRLQESSDGVIGANEWFHAAGSDAEENALLAQVMALSQQEFMNSLKKK
SAKEQNDADQAGSSKSS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacgatactgcctaaaccgaagaaagtgataaaaagcgccgaacggcatagttcacag
caaacagggacttcatctagtaaaagcagtcattctttgggtgcatcttcaccggaaact
aataaacaaccaagacaaagcactcctgaggaaaatccaggtgctccaattattaattct
gatgatgaggatggttccggttttaaagatgataatcttgaagcttggtttgaggagcgt
ttgcgttgtgtacgtggtcttgtgatcaagcctgttcgaggggatggagcatgtctcttt
cgagctgttgcggatcagatatatggtgatgaagaaatgcatgacgatgttagacgactt
tgtatggactacatggagaagaacagtgatcatttctcacagtttgtgacggaagatttt
catgactacattacacggaaacggcgtcgcgatgctcatggaaatcatgtcgaattgcaa
gcaatttcggaaatgttttcacgcccaatcgagatttacgagtattgcactgagccccga
aatatctccagctctcgtctagattcctccccttctgcagaaccgaacccacccattcgt
ctttcatatcatggtgcaattcattataattcagtcattgatccgactaaagcgacaatc
ggagttggtttgggattgcctgagtattcacctggagcagcggacagaagcctattacaa
gaagcaatgcagaaatcggaagttcaaatgatcgaggatgctatgctgcatgataaaatt
aaaatgactgattttgagcgtacagagcaagatattagtgaacagatagctcgacaatct
tacttggattatttgaaaagtctcagtaaaactggaaatgctgaaatgagagaaacagca
tatgcggtttcggaaccaggttgctcacatgcaaatgttcgacttcaggaaagtagtgat
ggcgtaataggtgccaacgaatggtttcatgcagcaggatcggatgccgaggaaaacgca
ttgttggcacaggtaatggcgctttcacaacaagaatttatgaattcattaaagaagaaa
tcagcaaaggagcaaaatgatgctgatcaagctggttctagcaagtcgtcgtag

DBGET integrated database retrieval system