KEGG   Brugia malayi (filaria): Bm1_06570Help
Entry
Bm1_06570         CDS       T01050                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase 1 (EC:1.3.99.5)
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     Bm1_06570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 131 aa AA seqDB search
MQGKWHSCNNVVYNESPMNTLFCFIGTSTFIIGMIINITSDSILRNLRKDGKSNYKIPYG
GLFEYISGANFFGECIEWIGYALLARTPPAFAFAFSTLCNLAPRAYHHHRWYHEKFDNYP
KDRKAFIPFVI
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggcaaatggcattcttgtaataatgttgtttacaacgaatcaccgatgaacact
ttattttgtttcattggtacatcgacatttattattggaatgataattaatattacatcc
gattcaatactacgaaatttacgaaaagatggaaaatcaaattataagataccttacggt
ggtttattcgaatatatctcgggagcaaatttttttggagaatgtatcgaatggattggt
tatgcgttattagcacgcacaccacccgcttttgcattcgcattttccacattatgcaac
cttgcaccacgcgcatatcatcatcataggtggtaccatgaaaagtttgacaattatccg
aaggatcgtaaagcttttataccatttgttatttag

DBGET integrated database retrieval system