KEGG   Brugia malayi (filaria): Bm1_07620Help
Entry
Bm1_07620         CDS       T01050                                 

Definition
eukaryotic translation initiation factor 4E-1
Orthology
K03259  
translation initiation factor 4E
Organism
bmy  Brugia malayi (filaria)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Bm1_07620
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Bm1_07620
Translation factors [BR:bmy03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Bm1_07620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 243 aa AA seqDB search
MAIDNLVPERSEPETIMMKCNGDAIHHPDEEXDLTCDISESKIGTLVPNHPLKYIWTYWY
LNDQRDKSWEKRLKVVSNFGTVEEFWALYVNIRPPSLLPTACDYSVFKKDIQPMWEVPEN
AKGGRWLITIDKSRHHDLLDVIWLEVLLAVIGQQFGKYTADICGVVVNIRNKGSKISIWT
TDCNNDESNCKIGEILKQKLTNPDIDSKIQRPIFDVLRYEDHQEVQNKSSSSVKAKHIIT
ASD
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggctattgataatttagtaccggaacgatcagaacctgagacgattatgatgaagtgc
aacggtgatgcgattcatcatccagatgaggaarcagatcttacctgtgacatatcggaa
tcgaaaattggtacgctagttccgaatcatccattaaaatacatttggacatattggtat
ttgaatgaccaacgtgataaaagctgggaaaagcggcttaaagttgtgtccaattttggt
acggtggaagaattttgggctctttatgttaatattcgtccaccatcattactaccaacg
gcttgcgattatagtgttttcaaaaaggatattcaaccaatgtgggaggttcccgaaaat
gctaaaggtggtcgctggctgataacgattgacaagtctagacatcacgatctgttggat
gtgatttggttggaagttttgttagccgtaataggccaacagttcggtaaatatacggcg
gatatatgtggtgtagttgttaacataagaaataaggggtccaagatcagtatttggaca
acagattgtaacaacgacgaatctaattgcaaaattggagaaatattaaagcagaaattg
acgaacccggatatcgattcaaaaattcagcggccaatatttgatgtacttcgctatgaa
gatcaccaagaggttcaaaacaagagttctagttcggtgaaagccaagcatattatcaca
gcttctgattag

DBGET integrated database retrieval system