KEGG   Brugia malayi (filaria): Bm1_07755Help
Entry
Bm1_07755         CDS       T01050                                 

Definition
hypothetical protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Bm1_07755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 485 aa AA seqDB search
MSKRSKKDRSLPPAASPPELLTPSTVLKVGEAFIVLRRAPNKNGVTDERCLATVVEIREG
EQASTSASSTSTITTTTTLSSDDMDVCKVCTNLLNDVSGENVSVEADIAARKEQFKMYYV
HYDGMDRRLDEWVGRNRIVARANPNAFTSVLSVPSSLTGTLESGTLTRSQRRIHEEFNHV
QRSYEDMDATTAKLEKEHAEMTKVKNIDKIRYGDYEIDAWYVSPYPDEYSKAAILYICEY
CLAYMRTEAEYCCHMLHYCDRRQPPGDEIYRDGNLSVYEVDGKTNKAYCQCLCLLSKLFL
DHKTLFFDVETFLFYVLCEVDEVGAHVVGHFSKERLSANNLACIMVLPPFQRKGYGKLLI
QLSYELSSREGVIGTPEKPLSDLGKVSYRSYWWWILLEALDRLNIDDVTVSDLSSASGVA
EDDIISTLQTMQLIKYWKGDHVVRMTRRLVEHCKSISMGRPPKLLLDPDLLRWWPKKRRQ
ISHRD
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacgttcgaaaaaagatcgttcattgccacctgcagcatcaccaccagaattg
ttaacaccatcaacagtgctaaaagtgggtgaagcatttattgtattacgtcgagcaccg
aacaagaatggcgtaacggatgaacgctgtcttgcaacggtcgtggaaattcgtgaaggt
gaacaagcaagcacatctgcatcttctacttcgacaattacaactaccaccactttatca
tcggatgatatggatgtctgtaaggtttgcacaaatttattaaatgatgtgtcgggtgaa
aacgtttcggtagaagcggacattgctgcaagaaaggaacaatttaagatgtattatgtt
cattacgatggcatggatagacgactggatgaatgggtgggaagaaatcgtattgtggca
agagcaaatccgaacgcttttacttctgttttgtcggtaccatcatcgttaactggtacc
ctggaaagtggaacgttaactcgaagtcagcgacgtatacacgaagaatttaatcatgtg
caaagaagttatgaagatatggatgcaacaacagcaaagcttgaaaaagaacatgcagag
atgacaaaagtaaaaaatatcgacaagatacggtacggtgattatgagatagacgcatgg
tacgtctcaccatatccggatgaatatagtaaggcagcaatactgtacatatgtgaatat
tgtttggcttatatgcgaacggaagcggaatactgctgtcatatgttacattactgtgat
cgacgacaaccgccaggtgatgaaatatatcgtgacgggaatttatcggtttatgaagtt
gacgggaaaacaaataaggcttattgtcaatgtctttgcctgctatcaaaattattcctg
gaccacaaaacgctattttttgatgttgaaactttcttgttttatgtgctgtgcgaggtt
gatgaagtaggcgctcacgtggttggtcatttttctaaagaacgactttctgcaaacaat
cttgcgtgtattatggttttaccgccgtttcaacggaagggttacgggaaattgcttata
cagttgagttatgaattgtccagtcgtgaaggagtaattggaacgcccgaaaaaccgttg
tctgatttggggaaagttagttaccgtagctactggtggtggatattactagaagccctt
gataggctgaatattgatgatgtaacggtatcagatttgagttctgcttctggtgttgcc
gaagatgatataatttctaccttacaaacaatgcagttaattaaatattggaaaggtgat
catgtcgtacggatgacaagacgacttgttgagcactgcaaatcaattagtatgggacgt
ccacccaagttacttcttgatcctgatcttttacgttggtggccaaagaaacggcgtcag
atcagtcatcgcgactaa

DBGET integrated database retrieval system