KEGG   Brugia malayi (filaria): Bm1_09150Help
Entry
Bm1_09150         CDS       T01050                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bmy  Brugia malayi (filaria)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bmy00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 196 aa AA seqDB search
MKPIVISGPSGGGKSTIITRAMQAYPNAFAFAVSHTTRKPRPGEIDGKNYWFITEKKFNE
MIKDNEFLEYATFGGNIYGTSKKALEDISKAGCICILDVELQGVRTIHKCGLDAKYILIR
APSLEILEQRLRARETETEESLKKRMKHAEDDLNAVDAEPTLFDFVIVNDDFERAYNDFL
TAIKEELSEFMSQRTK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctattgtaatatcaggtccatcaggtggaggtaaaagtaccattattactaga
gcaatgcaagcatatccgaatgcgtttgcatttgctgtttcacatacgacacgaaaacca
cgacctggagagattgatgggaaaaattattggtttataaccgagaaaaaatttaacgaa
atgatcaaagataatgaatttctggagtatgcaacttttggtggcaatatctacggaaca
tcgaaaaaagcattggaagatatatcgaaagcagggtgtatatgcatcttagatgtggag
ctacagggtgtccgtactatacacaaatgtggattagatgcaaaatatattctratcaga
gcgccaagtttggaaatattggaacagcgcttgcgtgctcgtgagacagaaaccgaagaa
tcgttgaaaaaacgcatgaaacatgcagaagacgatttaaatgctgtggatgccgagccg
actttatttgattttgtgatagtaaacgacgatttcgaacgagcctataatgatttttta
acagcaattaaagaggagttgagcgaatttatgtctcaaaggacgaaataa

DBGET integrated database retrieval system