KEGG   Brugia malayi (filaria): Bm1_09150Help
Entry
Bm1_09150         CDS       T01050                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bmy  Brugia malayi (filaria)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bm1_09150
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Bm1_09150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 196 aa AA seqDB search
MKPIVISGPSGGGKSTIITRAMQAYPNAFAFAVSHTTRKPRPGEIDGKNYWFITEKKFNE
MIKDNEFLEYATFGGNIYGTSKKALEDISKAGCICILDVELQGVRTIHKCGLDAKYILIR
APSLEILEQRLRARETETEESLKKRMKHAEDDLNAVDAEPTLFDFVIVNDDFERAYNDFL
TAIKEELSEFMSQRTK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctattgtaatatcaggtccatcaggtggaggtaaaagtaccattattactaga
gcaatgcaagcatatccgaatgcgtttgcatttgctgtttcacatacgacacgaaaacca
cgacctggagagattgatgggaaaaattattggtttataaccgagaaaaaatttaacgaa
atgatcaaagataatgaatttctggagtatgcaacttttggtggcaatatctacggaaca
tcgaaaaaagcattggaagatatatcgaaagcagggtgtatatgcatcttagatgtggag
ctacagggtgtccgtactatacacaaatgtggattagatgcaaaatatattctratcaga
gcgccaagtttggaaatattggaacagcgcttgcgtgctcgtgagacagaaaccgaagaa
tcgttgaaaaaacgcatgaaacatgcagaagacgatttaaatgctgtggatgccgagccg
actttatttgattttgtgatagtaaacgacgatttcgaacgagcctataatgatttttta
acagcaattaaagaggagttgagcgaatttatgtctcaaaggacgaaataa

DBGET integrated database retrieval system