KEGG   Brugia malayi (filaria): Bm1_09170Help
Entry
Bm1_09170         CDS       T01050                                 

Definition
Ubiquitin carboxyl-terminal hydrolase, family 1 protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
bmy  Brugia malayi (filaria)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 208 aa AA seqDB search
MRKIGVEKGVECVDVYGFDDDILAFIPRPCYAVILCFPMVDKVDEIMKPIYKKMEEEGSV
IPDGVFFMKQKISNACGTFALIHSLANNHNKIDLGNGSLKQWLDKAVTLGVEERSDSLAE
NSTLAEAHDNCARDGETDSSTPVDHHFICYLNYGDKLLELDSRAPSPRICGLTSDATFLK
DVGNSCKALMNKLENVSFSALAIVRAPH
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaattggcgtggagaaaggagtagaatgtgtagatgtatacggttttgatgac
gatatattagctttcatcccacgtccatgttatgctgttatattatgtttcccaatggtt
gataaggttgatgaaatcatgaaacctatctataaaaaaatggaggaggaaggaagtgtg
ataccggatggtgtcttttttatgaaacaaaaaatatcaaatgcttgtggaacttttgct
ctcattcattcacttgccaataatcataacaaaattgatcttggcaatggatcactgaag
cagtggttagataaagcagtaacgttgggtgttgaagaaagatctgattctttggcggaa
aactcaacacttgctgaagctcatgataattgcgctcgagatggtgagaccgattcgagt
acgcctgttgatcatcatttcatttgctatcttaactacggtgataaacttctagaactt
gattctcgtgctccatctcctcgtatttgtggtctgaccagtgatgcaacattcctgaaa
gatgttggaaattcatgcaaagcattgatgaacaaactggagaatgtgtcatttagcgct
cttgcaatcgttcgtgcgccycactaa

DBGET integrated database retrieval system