KEGG   Brugia malayi (filaria): Bm1_09295Help
Entry
Bm1_09295         CDS       T01050                                 

Definition
(RefSeq) Histone deacetylase 1
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
bmy  Brugia malayi (filaria)
Pathway
Longevity regulating pathway - multiple species
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Bm1_09295
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Bm1_09295
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Bm1_09295
Chromosome [BR:bmy03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     Bm1_09295
   HDAC complexes
    Sin3A-HDAC complex
     Bm1_09295
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Bm1_09295
  Chromatin remodeling factors
   NuRD complex
    Bm1_09295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
AA seq 481 aa AA seqDB search
MPMSVQDHSKRRVAYYYDANVGNYYYGQGHVMKPHRIRMTHHLLLNYGIYRNLEVYRPFP
ATFEEMTRFHTNEYMMFLRTATPDNLKQFNKQMLKFNVGEDCPVFDGLFEFCQLSCGGSL
AAAVKLNKRKADIAINWMGGLHHAKKSEASGFCYTNDIVLGILELLKYHKRVLYVDIDVH
HGDGVEEAFYTTDRVMTCSFHKYGDFFPGTGELKDIGAGRGKYYAVNVPLRDGITDESYQ
SIFVPVMERVMETFQPCAVVLQNGADSLNGDRLGTFNLTLRGHGACARFFRERHIPLMML
GGGGYTPRNVARCWTYETSIAVDMEVSDDLPYNDYFEYFGPHYRLHIDPSNANNENTPEF
LRKIQEGVMENLRHLPHVPSVQMQPVGDESFVAKCLNAEEADRDNANPDVRLHHTMMDAS
TEDQGEFYDNEKEGGDIRNEQSFKRCGSETETGDAETTKKPKMECYQNYVKERLEKEGTK
F
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgtcagtacaagatcacagcaaacgtcgtgtagcttattactatgatgccaac
gttgggaattattactacggacaaggtcatgtgatgaagcctcatcgtattcgaatgact
catcatctcttgctcaattatggtatctacagaaatctggaagtttatcgtccattccca
gcaacattcgaagagatgacgcgatttcacacaaatgaatacatgatgtttttgcggacg
gctacaccggataatttgaaacagttcaacaaacaaatgttgaaatttaacgtcggtgaa
gattgtccagtttttgatggattatttgagttttgccagctctcatgtggtggttcttta
gcagctgcagtaaagttgaacaaacggaaagccgacatagcaataaactggatgggaggt
ttgcatcacgcaaaaaaaagtgaggccagtggcttttgctacactaatgatattgttttg
ggtatcctcgaacttctcaaatatcacaagagagtgctttacgttgatattgatgtacac
catggtgatggtgttgaggaggctttctatactacggatcgggtgatgacatgttctttt
cataaatatggtgattttttcccgggaacaggagaactgaaagatattggtgctggaaga
ggaaaatattatgcagttaatgtacctttgagagatggtatcactgatgagtcatatcaa
agcatttttgttccggtcatggaaagagttatggaaacattccaaccatgtgctgtagtt
ctgcagaatggagctgattctttgaatggtgatcgcttaggcaccttcaatcttactttg
agaggtcacggtgcttgtgctcgatttttccgggaacgacatattccactgatgatgtta
ggtggcggtggttacacacctagaaatgtggctcgatgctggacttatgagacttcaatt
gccgttgatatggaagtctctgacgatcttccatacaacgattacttcgaatattttgga
ccgcattatcgacttcacattgatccctcaaatgctaataatgagaacaccccagaattt
ttgaggaaaattcaagaaggagtgatggagaacttacgacatttaccgcatgtgccaagt
gtgcaaatgcagccggtcggcgacgaatcttttgtcgcaaaatgcctcaatgccgaagaa
gctgatcgtgacaatgcaaatccggatgtccggctacaccacactatgatggatgcttct
actgaagatcagggtgaattctatgataatgagaaagaaggaggtgatatacgaaatgaa
cagtctttcaaacgttgcggatcggaaacggagaccggtgatgctgaaacaacaaagaag
ccaaaaatggagtgctatcaaaactacgtgaaagagcgattagaaaaggaaggaacgaag
ttttag

DBGET integrated database retrieval system