KEGG   Brugia malayi (filaria): Bm1_10515Help
Entry
Bm1_10515         CDS       T01050                                 

Definition
Serine/threonine-protein kinase F42G10.2
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Bm1_10515
   04012 ErbB signaling pathway
    Bm1_10515
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Bm1_10515
Protein kinases [BR:bmy01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Bm1_10515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 364 aa AA seqDB search
MAEQKLCGVGRFNLKLDFPPLPDVKSSPQLAYLRTHSAGKLRFSLGEEYEFTCNDLIDKG
EIGRGNFGTVSRMLHAKSGTVLAVKRIRSNTVNSTEQKRLLMELEAIMSSQCENIVRFYG
AIFTEGDCWICMELMDISLENLYKIVYEKGSCLPENMIGYVAVSTVNALSYLKEDLRIIH
RDVKPSNILLDRKGHIKLCDFGIAGHLIDSIAKTQDAGCRPYMAPERLQSNEPYDVRSDV
WSLGITLFEVSTGRFPFSAWDSPFQQLQEVVNGEPPIMPPGIYSACLVTFINHCLIKGRD
ERPKYNVLMTMDFYKTYNAQDANGAAQAQTIVGIFVSKVLGDSNTSENVNNTYKALRSDW
VHFS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacagaaattatgtggtgttggacgtttcaatctaaagctcgactttccaccg
ttacctgatgtgaaatcatcaccacagctcgcatatctgcggactcactccgcaggcaaa
ttacgtttttcgctgggtgaagaatatgaatttacatgtaatgatctcatcgacaaaggc
gagatcggtcgtgggaattttgggacggttagccggatgcttcatgcaaaatccggaact
gttttagctgttaaacgtatccgatcaaatactgtgaactcaacagagcagaaacgtttg
cttatggaacttgaagcaattatgagtagccagtgtgaaaacattgttcgcttttacggt
gctatctttaccgaaggtgactgttggatatgcatggaattaatggatatttctctagag
aatctttataaaatagtttatgaaaaaggaagttgtcttccggaaaatatgatcggatat
gttgcggtttcaacagtgaatgctctcagttatcttaaggaagatttaagaataattcat
cgggatgttaagccgtccaacattctgctggatcggaaaggacatataaagctatgtgat
tttggtatagccggtcacttaattgattccattgcaaaaactcaggatgcaggttgtcgg
ccatatatggcaccggaacgactccaatcgaatgaaccatatgatgttcgatctgacgtt
tggtcgttgggcataactctatttgaagtttcaacaggacgttttccattctcagcttgg
gattcaccgtttcaacaattacaagaagtcgttaacggtgaacctcccattatgccacct
ggaatatattccgcgtgtttagttacatttatcaaccactgcttaatcaagggcagggac
gaacgccccaaatacaatgttctaatgaccatggatttctacaaaacatacaacgcgcag
gatgcaaatggagctgctcaagcgcagacaattgttggaatatttgtttctaaagttctt
ggggatagtaataccagtgaaaacgtcaacaatacgtacaaagcacttaggtctgactgg
gtgcatttttcctga

DBGET integrated database retrieval system