KEGG   Brugia malayi (filaria): Bm1_10875Help
Entry
Bm1_10875         CDS       T01050                                 

Definition
dihydrolipoamide S-acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmy  Brugia malayi (filaria)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bm1_10875
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bm1_10875
   00020 Citrate cycle (TCA cycle)
    Bm1_10875
   00620 Pyruvate metabolism
    Bm1_10875
Enzymes [BR:bmy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bm1_10875
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 303 aa AA seqDB search
VRYETIGTASAVPKANTMTATTGNYGSSIISPSRAMKSEGNRIVAMPYARKLTTVPGINL
LEIDDINSNGRHNIAKVSKTATDNIAMNEKINKIYPHYYLTSEIKMDELLKMRVNLNADL
KDQSVKISINDFVIKASALACMDVPEVNSFFLEKEKVIRQNLTVDISVAVKTETGLITPI
IHSAHIKSLAQISTEIKQLANKAHNNKLKPNEYMGGTFTVSNLGMFGSIHHFTAIINPPQ
SCILAVAGSERKVVPDDNENGFKIITTMLVTMSCDHRVVDGAVGAIWLKHFKEYMEKPET
MLM
NT seq 914 nt NT seq  +upstreamnt  +downstreamnt
gtgttcggtatgaaacaataggtacagcttcggctgtacctaaagctaatacgatgactg
caacaaccggaaactatgggtcatctattatctctccttctcgagctatgaaatccgaag
gtaatcgtatcgttgctatgccatatgcccggaaattaactactgtcccgggtatcaact
tgttggaaattgatgatatcaattcaaatggacgacataatattgcaaaagtaagcaaaa
ctgctactgataatattgcaatgaatgaaaaaataaacaaaatatacccacattattatc
ttacttctgaaattaaaatggacgaattattgaagatgcgagtaaatttaaatgctgatc
taaaagatcaaagtgtcaaaatatccataaatgattttgtcattaaagcatctgcattag
catgtatggatgtacccgaagtgaatagtttctttttagagaaagaaaaagttatccgtc
aaaatttaactgttgatatttctgttgctgtaaaaacagaaacaggccttataacaccta
tcattcacagtgctcatattaaaagtttggcacaaatcagtactgaaattaaacaattag
caaataaggcgcataacaataagctgaaaccaaacgagtatatgggtggtacatttactg
tatcaaatttgggaatgttcggtagcatacatcattttacagcaattatcaatccaccac
agtcatgcattttagctgttgctggttcagagcgtaaagttgtacctgatgataatgaaa
atgggtttaaaattataacaacaatgcttgtgacaatgtcttgtgatcatcgtgttgttg
atggtgctgttggtgcaatttggttaaaacattttaaggaatatatggaaaagcctgaaa
ctatgctaatgtaa

DBGET integrated database retrieval system