KEGG   Brugia malayi (filaria): Bm1_10875Help
Entry
Bm1_10875         CDS       T01050                                 

Definition
dihydrolipoamide S-acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bmy  Brugia malayi (filaria)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:bmy01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmy00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bmy00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bmy00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 303 aa AA seqDB search
VRYETIGTASAVPKANTMTATTGNYGSSIISPSRAMKSEGNRIVAMPYARKLTTVPGINL
LEIDDINSNGRHNIAKVSKTATDNIAMNEKINKIYPHYYLTSEIKMDELLKMRVNLNADL
KDQSVKISINDFVIKASALACMDVPEVNSFFLEKEKVIRQNLTVDISVAVKTETGLITPI
IHSAHIKSLAQISTEIKQLANKAHNNKLKPNEYMGGTFTVSNLGMFGSIHHFTAIINPPQ
SCILAVAGSERKVVPDDNENGFKIITTMLVTMSCDHRVVDGAVGAIWLKHFKEYMEKPET
MLM
NT seq 914 nt NT seq  +upstreamnt  +downstreamnt
gtgttcggtatgaaacaataggtacagcttcggctgtacctaaagctaatacgatgactg
caacaaccggaaactatgggtcatctattatctctccttctcgagctatgaaatccgaag
gtaatcgtatcgttgctatgccatatgcccggaaattaactactgtcccgggtatcaact
tgttggaaattgatgatatcaattcaaatggacgacataatattgcaaaagtaagcaaaa
ctgctactgataatattgcaatgaatgaaaaaataaacaaaatatacccacattattatc
ttacttctgaaattaaaatggacgaattattgaagatgcgagtaaatttaaatgctgatc
taaaagatcaaagtgtcaaaatatccataaatgattttgtcattaaagcatctgcattag
catgtatggatgtacccgaagtgaatagtttctttttagagaaagaaaaagttatccgtc
aaaatttaactgttgatatttctgttgctgtaaaaacagaaacaggccttataacaccta
tcattcacagtgctcatattaaaagtttggcacaaatcagtactgaaattaaacaattag
caaataaggcgcataacaataagctgaaaccaaacgagtatatgggtggtacatttactg
tatcaaatttgggaatgttcggtagcatacatcattttacagcaattatcaatccaccac
agtcatgcattttagctgttgctggttcagagcgtaaagttgtacctgatgataatgaaa
atgggtttaaaattataacaacaatgcttgtgacaatgtcttgtgatcatcgtgttgttg
atggtgctgttggtgcaatttggttaaaacattttaaggaatatatggaaaagcctgaaa
ctatgctaatgtaa

DBGET integrated database retrieval system