KEGG   Brugia malayi (filaria): Bm1_11345Help
Entry
Bm1_11345         CDS       T01050                                 

Definition
hypothetical protein
Orthology
K15293  
protein unc-13
Organism
bmy  Brugia malayi (filaria)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 126 aa AA seqDB search
HHCTEQDEVRLPEIKDDSWKVYFDDTGQEICDEFAMRYGIESIYQAMTHFACLCTRYMCS
GVPAVLSTLLANINAYYAHTTATSAVSASDRFNASNFGRDRFVKLLDQLHNSLRIDLSMY
RVNLLA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
catcattgcacggaacaggatgaagtacgattaccggaaataaaagatgattcatggaag
gtatattttgatgataccggtcaggaaatttgtgatgaatttgctatgcgttatggtatc
gaaagtatatatcaggcaatgacacattttgcgtgtctctgcacacgttatatgtgttcc
ggtgttccggccgtactctcaacacttctagctaatattaacgcatattacgctcatacg
accgctacgtcagctgtttccgcatctgatcgcttcaatgcttctaattttggccgcgat
cgatttgttaaactattggatcagttgcataattcattacgaattgatttatcaatgtat
cgggtaaatttgcttgcctaa

DBGET integrated database retrieval system