KEGG   Brugia malayi (filaria): Bm1_11790Help
Entry
Bm1_11790         CDS       T01050                                 

Definition
cAMP-dependent protein kinase catalytic subunit, putative
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Wnt signaling pathway
Hedgehog signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:bmy04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:bmy04310]
Environmental Information Processing; Signal transduction; Hedgehog signaling pathway [PATH:bmy04340]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:bmy04020]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 146 aa AA seqDB search
NTAQLDDFDRIKTLGTGSFGRVMLVKHKQNGSYYAMKILDKQKVVKLKQVEHTLNEKRIL
QAVDFPFLVNMEYSFKDNSNLYMVLEFIGGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFE
YLHSLDLIYRDLKPENLLIDNTGYIK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
aatacggcacaattagatgattttgatcgaatcaaaacacttggtaccggttcatttgga
cgtgtaatgttggtaaaacataaacaaaacgggtcgtattatgcgatgaaaattttggat
aaacaaaaagtggtgaaattgaaacaagttgaacatacacttaatgaaaagcgtatactt
caagcagttgatttcccatttttggtcaatatggaatattctttcaaagataattcaaat
ttgtatatggtgctcgaatttattggtggcggtgaaatgttctcacatttacggcgcatt
ggtcgtttcagtgagccacattctcgtttttatgcggcgcaaattgtgcttgcattcgag
tatctgcattcccttgacctcatttatcgagatctgaaacctgaaaatctccttattgat
aatacaggctatattaag

DBGET integrated database retrieval system