KEGG   Brugia malayi (filaria): Bm1_11790Help
Entry
Bm1_11790         CDS       T01050                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit, putative
  KO
K04345  
protein kinase A [EC:2.7.11.11]
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Longevity regulating pathway - multiple species
Wnt signaling pathway
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Bm1_11790
   04310 Wnt signaling pathway
    Bm1_11790
   04020 Calcium signaling pathway
    Bm1_11790
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Bm1_11790
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Bm1_11790
Protein kinases [BR:bmy01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Bm1_11790
Messenger RNA biogenesis [BR:bmy03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Bm1_11790
Chromosome [BR:bmy03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Bm1_11790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
AA seq 146 aa AA seqDB search
NTAQLDDFDRIKTLGTGSFGRVMLVKHKQNGSYYAMKILDKQKVVKLKQVEHTLNEKRIL
QAVDFPFLVNMEYSFKDNSNLYMVLEFIGGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFE
YLHSLDLIYRDLKPENLLIDNTGYIK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
aatacggcacaattagatgattttgatcgaatcaaaacacttggtaccggttcatttgga
cgtgtaatgttggtaaaacataaacaaaacgggtcgtattatgcgatgaaaattttggat
aaacaaaaagtggtgaaattgaaacaagttgaacatacacttaatgaaaagcgtatactt
caagcagttgatttcccatttttggtcaatatggaatattctttcaaagataattcaaat
ttgtatatggtgctcgaatttattggtggcggtgaaatgttctcacatttacggcgcatt
ggtcgtttcagtgagccacattctcgtttttatgcggcgcaaattgtgcttgcattcgag
tatctgcattcccttgacctcatttatcgagatctgaaacctgaaaatctccttattgat
aatacaggctatattaag

DBGET integrated database retrieval system