KEGG   Brugia malayi (filaria): Bm1_12180Help
Entry
Bm1_12180         CDS       T01050                                 

Definition
(RefSeq) Protein C20orf22
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     Bm1_12180
Peptidases [BR:bmy01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   Bm1_12180
Exosome [BR:bmy04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   Bm1_12180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 DLH Abhydrolase_2 Thioesterase Peptidase_S9 LIP Say1_Mug180 Lipase_3 LIDHydrolase DUF900 COesterase Esterase DUF2974 Peptidase_S15 BAAT_C
Motif
Other DBs
NCBI-GeneID: 6097360
NCBI-ProteinID: XP_001893906
AA seq 251 aa AA seqDB search
MSYRYSILNAREMELLMATENNPVIVYLHGNSFDRSQSTRCGLYNLLTNMGFHVLALDYR
GYGDSNGSPSENGLIEDAKEIFRYARSRSGSNNIYLWGHSMGTAIATAAAMEFSEKGLSP
TGLILESPFNNLSDVVTHHPYAIPFRWLPWFKNMVLESLDRSGLDMSTDYRITKVDCPVL
ILHAEDDHIIPLQLARKLRDSAMAAKRDVTLKEFDASRNFHHKFIYLAEELPRILRRFVE
KCTLKTKKAQE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagctatcggtactcaatattaaatgcgagagaaatggaacttcttatggcaacagaa
aataatccagtaattgtatatttgcatggcaattcatttgatcgatcacaatcaactcgc
tgtggattgtataatttattgactaatatgggttttcatgtgttagctttagattatcgt
ggatatggcgattcaaatggttcaccaagtgaaaatggtttaattgaggatgcaaaagag
atatttcgatatgccagaagtcgttcgggttcaaataacatatatttatgggggcattca
atggggacggcaattgctacagcagctgcaatggaattcagtgaaaaaggattgtcacca
actggtttgatcctagaatcaccattcaataacctcagtgatgttgttactcaccatcca
tatgcaataccatttcgttggttgccatggtttaaaaatatggtattagaatcattagac
agatccggtttagatatgagcaccgattatcgtatcacaaaggtggattgtccagttttg
atattgcatgccgaagatgaccatattattccgctgcagttggctcgtaagttacgtgac
agtgcaatggctgctaaacgtgatgtgacgctaaaagaattcgatgcaagccgtaatttt
caccacaaattcatctatctggctgaagaattgcctagaattctaaggcgatttgtggag
aaatgtactttraaaaccaagaaagcacaggaatag

DBGET integrated database retrieval system