KEGG   Brugia malayi (filaria): Bm1_12875Help
Entry
Bm1_12875         CDS       T01050                                 

Definition
Serine/threonine protein phosphatase PP1-beta catalytic subunit
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
bmy  Brugia malayi (filaria)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:bmy03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 334 aa AA seqDB search
MASDSDLNVDHLITRLLEVRGCRPGKTVQMSENEIRALCHKSRDIFLSQPILLELEAPLK
ICGDIHGQYNDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFL
LRGNHECASINRIYGFYDECKRRFSIKLWKTFTDCFNCLPIAALIDEKIFCCHGGLSPDL
QNMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGPDVVAKFLNRHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSE
KKAKYQYAGLNSGRPITSPQRAAGAATGGIQKKK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgacagtgacctcaatgttgaccatcttattacacgacttttagaagttcgc
ggatgtcggcccgggaagactgtccagatgtcggaaaatgaaataagggcactctgtcat
aaaagcagggatatctttttgtcacagcccattcttttggaactcgaggcgcctctcaaa
atttgtggagatattcacggacaatacaatgatttattacgattatttgaatatggtgga
tttccgccggaggcaaattatctttttcttggagattatgttgatcggggaaagcaaagc
ttggagacaatatgcttactgctggcgtataaggtgaaatatcccgaaaatttctttttg
ttacgaggaaatcatgaatgtgctagtattaatcgtatttatggattttatgacgaatgc
aaacgtcgattttcgataaagctatggaaaacattcactgattgtttcaattgcctacca
atagccgccctcatagatgaaaaaatcttctgttgtcatggaggactttctcctgatcta
caaaatatggaacagatccgaagaataatgcgaccaacggatgttccagatactggtctt
ctctgtgatttgttatggtctgacccggacaaggatgtgcaaggttggggagaaaacgat
cgaggagtatcgtttacattcgggcctgacgttgtagcaaaattcttaaatcgtcatgat
ttagacttaatatgtcgggcacatcaggtagtagaagatggctacgaattttttgccaaa
cgtcaacttgtaacattattttcggccccaaattattgtggtgagttcgataatgcaggt
ggtatgatgagcgttgatgaaacactaatgtgttcctttcagatcttaaagccatccgag
aagaaggccaaatatcagtacgctggattgaacagtggtcgtccaattacatcgccacag
cgagcggctggtgcagcaactgggggaattcagaaaaagaagtaa

DBGET integrated database retrieval system