KEGG   Brugia malayi (filaria): Bm1_13120Help
Entry
Bm1_13120         CDS       T01050                                 

Definition
Type III restriction enzyme, res subunit family protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
bmy  Brugia malayi (filaria)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bm1_13120
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     Bm1_13120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 805 aa AA seqDB search
MPDDDDDADTMVSQDEEIHCCYEVLYGKISSRRHKRWQGDGLLYCRKRSTILLTEDGEEV
ARTSGYSFKQLRELKVGSQLKVSNYEVEVQNEPNPQKLAEFGKQPIVAELAGSSAAHGES
SKKKRRITDQIFISPLFGRDNPLDLVLDETKDDDGFVRRIAVDVQIARHLRPHQKDGVAF
MYRCLKNSHGGALLADEMGLGKTVQTISLITALVKKRLNQKPIIRKCIIVVPTSLLNNWY
AEFMRWSPQTQTMLFRILKSTDVKKLISYRNTSMIAIVSYEMIARTAAKLSVVSVDLLVC
DEAHRIKNLNGRLREQLQILHAQRRLLLTGTPMQNDLEEFYSLVNFARPDLFISFLEFKN
LCEMESTRFNELLSEVMLRRTAEVIHDLLPPKIDYIVWCRPSALQCSIYKNLKKFLPYDH
LTLIDALRKLCNHPFLLYQSMVVKRQTCKVEEREFYNAFLQSFPNTFNAFSLSTTDSGKL
NVFVELLATFREQEEKVVIVSNFTQTLDLLEELCRTLYYTILRLDGSTEAKKRMEIVEEF
NSLSNKNYAFLLSAKAGGLGLNLVGANRMILFDSDWNPAVDMQAMARIWRQGQEKPCHIF
RLITAGTVDEKILQRQIKKSSLNTIVEMVPVESLTHFSDEELQDVFTLRDDAECETHFLL
ECQCDGRGFLPEELEVDQEISSDENSAFYPDVEHVTTYSEGMDENYDHTSVAEDSLQPSL
NSLMQNCIDTIHFASTTNEVHEDDAGNKILGDEAALSSSALMGTLMRWQHHSPKHDQFES
LKAEADLEECCLDEVSFIMKLVSNF
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatgatgatgatgatgctgataccatggtgagtcaagatgaagaaatacactgt
tgttacgaagtactttatggtaaaatttcttcgagaaggcacaaaagatggcaaggcgat
gggttgttgtactgtcgtaaacgttctactatattactaacggaggatggtgaagaagtc
gcgaggacaagtggttattcatttaagcagttaagggaattgaaagtaggcagtcaactg
aaagttagtaattatgaagtggaagtgcagaatgagccaaatccacagaagcttgctgag
tttggaaagcaaccaatagttgctgaattggcgggaagcagtgcagcacatggcgagagt
tcgaaaaaaaagcgaagaattactgatcagattttcatttcaccactgtttggtcgggat
aatcctctggacttggtgttggatgagacgaaagatgatgatggttttgtacgacgaatc
gctgtggatgtgcaaattgctcgccacctgaggccacatcaaaaggatggcgtcgctttc
atgtacagatgtttaaagaattctcatggcggagctcttcttgctgatgagatgggtttg
ggtaaaactgtacagaccatttcgttgataactgcattagtcaaaaaacgattaaatcaa
aagccaataattcggaaatgtatcattgtggtaccgacatcactgctaaataactggtac
gcagaatttatgaggtggtcacctcagacacaaacaatgttgttccggattttgaagtca
acagatgtgaaaaagctaatttcgtatcggaacacatcaatgattgccatcgttagttat
gaaatgattgcacgcaccgctgcaaaactgtcggttgtttcagtcgatctgttggtttgc
gatgaagcacataggattaaaaatctgaatggaagactccgagaacaacttcaaattttg
catgctcagcgtcgtttattgctgacaggaacaccaatgcaaaatgatctggaagaattc
tattcattggttaactttgcacggccagatctttttatctctttcttggaattcaaaaat
ctttgtgaaatggagtcaactcgtttcaatgaattgctctccgaggtgatgcttcgccga
acagctgaagtgatccatgatttgctaccaccaaaaattgattatatagtttggtgtcga
ccatcagcgttgcaatgctctatatacaaaaatttgaagaaattccttccatacgatcac
ttgactttgattgatgccttacgaaagttatgtaatcacccgtttcttctttatcagagt
atggtagtgaaacgtcaaacttgtaaggtggaagaaagggaattttataatgcatttctt
caatcatttccaaatactttcaatgctttttctctttcaaccactgactcaggcaagctt
aatgtgtttgtcgagttactggcaacatttcgggaacaggaagaaaaagtggtcattgtt
tccaatttcacccagactcttgatctcttggaggagctttgtcgaactttatattatact
attctacgattagatggatcaacagaagcgaaaaaaagaatggaaattgttgaagaattc
aattctttatcaaataagaattatgcattcttattgagtgctaaagcaggtggacttggc
ttaaatctcgttggtgctaatcgaatgattttgttcgactcggactggaatccagctgtg
gatatgcaagcgatggctcgtatttggcgacaaggacaagaaaaaccatgtcacattttt
cgacttatcacagcgggtactgtggatgaaaagattttgcaaagacaaatcaaaaaaagc
agtctcaatacaatagttgaaatggtcccagttgaatcacttacgcatttttctgatgaa
gaattgcaagatgtttttacacttcgtgatgatgctgaatgtgaaacacattttttattg
gaatgccaatgcgacggacgtggttttttgccagaagaactggaagtcgatcaagaaata
agttctgatgagaattctgcattctatccggatgttgagcatgttactacatacagcgaa
ggaatggatgaaaattacgaccacacgtcagttgcagaagattctctgcagccatcatta
aattctttaatgcagaattgcatcgatacgatccattttgcttccactaccaacgaagtg
catgaagatgacgctggaaataaaatattgggagacgaagcggcattatcatcgagcgcg
ttgatgggaacattgatgcgttggcagcatcactccccaaaacatgaccagtttgaatct
ttgaaagctgaggctgatttggaagaatgctgtctagatgaagtttcgttcataatgaag
ttggtctcgaatttctga

DBGET integrated database retrieval system