KEGG   Brugia malayi (filaria): Bm1_13480Help
Entry
Bm1_13480         CDS       T01050                                 

Definition
(RefSeq) UDP-glucoronosyl and UDP-glucosyl transferase family protein
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
bmy  Brugia malayi (filaria)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bm1_13480
   00053 Ascorbate and aldarate metabolism
    Bm1_13480
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Bm1_13480
   00860 Porphyrin and chlorophyll metabolism
    Bm1_13480
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    Bm1_13480
   00982 Drug metabolism - cytochrome P450
    Bm1_13480
   00983 Drug metabolism - other enzymes
    Bm1_13480
Enzymes [BR:bmy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     Bm1_13480
Glycosyltransferases [BR:bmy01003]
 Others
  Hydrophobic molecule
   Bm1_13480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 538 aa AA seqDB search
MYHAEWYLASLIIIFHASQNDSYKILVYNPRFGKSHTKFLGSIADTLVNAGHNVTEFAPV
LFEFSDSTGSKLAKTVKIDADPEISKIMNVEIFAQDAWKRNQQSIFSLISVMKRMSDALL
KNCEFQLKQEKIMQELKSEKFDLAIFEFNQCFAGIIELLRIPAHIVVSPTALFEYAIECF
GIPNIPSYIPSLLTQYTDKMTYLQRLKNLIITILTTKLLDNHTIRCQALFRRLYGDQFID
LKEKLAQVTYVLTNTDPLFHISRPTIHKMLELGGLALPKPQPLSKEWIAVMNKRKAVVLV
SFGTVTLSCWMPNETKQALLDAFDSFPNVTFIWKYEKDEHLIAEGRPNVITSKWLPQSDL
LAHKNLIAFLTHGGMNSITETLNRGKPIVVVPLFGDQMQNAVLVQRLGLGIKLSLSELAI
KEKIKNAIYNIIYDKSYAQKVERLSKMMAKKPNQAEEQLIKHVEFAAEFGQIANFDPYGR
KMSFVSYYMLDIIIPFIILIFFIITIICYLIIRLFRKLFHKAVICNNNNSIITKVKKN
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtatcatgctgagtggtatttggcttcactcattattatatttcatgcatcacagaat
gattcatataaaatattggtatataatccacgttttggtaaaagtcacaccaaatttttg
ggttcaatcgctgatacattggttaatgccgggcataatgtaaccgagtttgctcctgta
ctttttgaattttccgattccactggttctaaattggctaaaacagtaaaaatagacgct
gatccggaaatatcgaaaataatgaacgtagaaatttttgctcaagatgcatggaaacga
aatcagcaatccattttctcattgatttcggttatgaaacgaatgtcggatgctcttctg
aagaattgtgagtttcaactaaagcaggaaaaaataatgcaagaattgaaatctgaaaag
tttgacttagctatcttcgaatttaaccaatgctttgccggaataattgaattgcttcgt
ataccggctcatattgtcgttagtcctactgctctatttgaatatgccatagaatgtttt
ggtataccaaatattcctagctatattccaagtttgcttacacagtatactgataagatg
acatatttacaacggctgaagaatctcatcataacaattttaacgactaaattgctggat
aatcatacaataagatgtcaagccttgtttcgacgactttacggcgatcaatttatcgat
ttgaaagaaaagttagctcaagtgacatatgttctcacaaatactgatccactttttcac
atctcaaggccaactattcacaaaatgttggaacttggtggtcttgccttaccaaaaccg
caaccgctaagtaaagaatggattgcagtgatgaataaacggaaagcggtagtgcttgta
tcattcggcaccgttacactgagttgttggatgcctaacgaaactaagcaagcacttcta
gatgcattcgatagttttcccaatgtgacatttatctggaagtatgaaaaagatgagcat
ttaatcgctgagggacgtccaaacgtgattacgtcaaaatggcttccacaatctgatttg
ttagcacataaaaatttgatagcatttttgacgcatggtggtatgaatagcataacggaa
actttgaatcgtggaaaacctattgttgtggtaccgctatttggtgatcagatgcagaat
gctgtattagttcaacgattaggtcttggtatcaaattatccctttcggaacttgcgata
aaagaaaaaataaaaaatgcaatttataatatcatctatgacaaaagttatgcccaaaaa
gttgaaagattatcaaaaatgatggcaaaaaagcctaatcaagctgaggaacaactcatt
aagcatgttgaatttgctgcagaatttggtcaaatagcgaatttcgacccatacggcaga
aaaatgtcatttgtatcttattatatgcttgatattatcattccttttataatacttata
ttctttatcattacaatcatttgttaccttatcattagactattcagaaaattattccac
aaagctgttatctgtaataataataatagtattataacaaaggtgaaaaaaaattaa

DBGET integrated database retrieval system