KEGG   Brugia malayi (filaria): Bm1_13550Help
Entry
Bm1_13550         CDS       T01050                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
bmy  Brugia malayi (filaria)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Bm1_13550
   03420 Nucleotide excision repair
    Bm1_13550
   03430 Mismatch repair
    Bm1_13550
   03440 Homologous recombination
    Bm1_13550
   03460 Fanconi anemia pathway
    Bm1_13550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 302 aa AA seqDB search
MDGNGWGEESYDAGIAGGWGEASFVEADEYKECQHTTKVPFPATIKDLSQLASNEEKITT
GKYTFSTIRVVGHVKESLQTDGGQSVEYTLSDYHDTYATFLVIHYKGVLASAAANSDAVV
EGTDISVVGKLRSFSERLCIVAFDVREIEDKREIDAFHLEARLARLFYAKDVLDIALSEK
WIALSADTMLRVNETDGGQTKTTSDWKSNIKSNLKSSSLMQQSSSRSIPDSGCRGLTGQK
AEIFKYLRSNGDPVIGASIDDIRTGIPKNHFNSSKFAEDIEYLASEGLIYATSDDDHYAA
NA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggatggaaatggatggggtgaagagagttatgatgctggaattgctggtggttggggt
gaagcatcatttgtggaagctgatgaatacaaagaatgccaacacaccacgaaagtacca
tttccagctacgatcaaagatcttagtcagttagcaagcaatgaagagaaaataacaacc
ggtaaatataccttcagtacgattcgagttgttggccaygtgaaggaatcgctacaaaca
gatggaggacaatctgtcgagtatacattatctgattatcatgatacatatgccacattt
ctcgtcattcactacaaaggcgtgcttgcaagtgctgcagcaaattcagatgcagtagta
gagggaacggatatttctgttgtgggaaaattgcggagttttagtgaacgactttgtatt
gttgcttttgatgttcgagagatagaggataagagagagattgatgcttttcatttagaa
gctcgacttgctcgccttttctatgcgaaagatgtgctggatatagcattatcagaaaaa
tggatagctttatccgcagatacaatgttacgtgtaaatgaaacagatggaggacaaact
aaaacgaccagcgattggaagagcaatataaaatctaatttgaaatcaagcagtttaatg
caacaaagttcatcacgatcaattcctgatagtggttgtcgtggattaactggtcagaaa
gctgagatatttaaatatttgcgtagtaatggcgatccagttattggagctagtattgat
gatatacgtactggcatcccaaaaaatcactttaattcatccaaatttgccgaggatatt
gaatatttagcttctgaaggcctgatttatgctacttcagacgatgatcattatgccgcc
aatgcataa

DBGET integrated database retrieval system