KEGG   Brugia malayi (filaria): Bm1_13860Help
Entry
Bm1_13860         CDS       T01050                                 

Definition
(RefSeq) Cyclin, N-terminal domain containing protein
  KO
K06634  cyclin H
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy03022  Basal transcription factors
bmy03420  Nucleotide excision repair
Module
bmy_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Bm1_13860
  Replication and repair
   03420 Nucleotide excision repair
    Bm1_13860
Transcription machinery [BR:bmy03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Bm1_13860
DNA repair and recombination proteins [BR:bmy03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     Bm1_13860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N Cyclin_C TFIIB
Motif
Other DBs
NCBI-GeneID: 6097693
NCBI-ProteinID: XP_001894236
UniProt: A0A0H5SDL0
AA seq 320 aa AA seqDB search
MFSTSTQKKEWTFSSQQDLLDLRKAANEKFRAKYGTVIDADQKDIFLTPEEEALLRNIVT
ETGIRFADDFRPTMWPSTRWTAFAYFKRFFLYHSTMEYSPKSVMMSCFYLAAKVDEFNIS
IDEFTKNLKSGTAKSNSETILSFEPQIMLKLHYQLTIHSPFRPFEGHLIEMKTRSLLGFD
LEQVRPHANDFFRKALFGDVMLLYPPSQIALAALKHALQMLDKADDLLKDQFLNKMLEID
TWKPQNDNVLICEKLIARLDEIIQCVLDGCKPIAPETNEALQSHMERWVNTFPELERRLS
VLNASLQENSNSNTALSDDD
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaactagtactcaaaagaaagaatggacattttcatcacaacaggatcttttg
gatctcaggaaagcagcaaatgagaaatttcgagcaaaatatggaacagtgattgatgct
gatcaaaaagatatatttttaacacctgaggaagaagcactattaagaaatattgtcaca
gaaactggcattaggtttgcggatgatttccgccctacaatgtggccatcaactcgctgg
acagcatttgcatattttaaacgtttctttctatatcactcaacaatggaatattcacca
aaaagtgtgatgatgtcatgcttttatttagctgcaaaagttgatgaatttaatatatcc
attgatgaatttactaaaaatttgaaatctgggactgctaaatcaaattctgaaacaatt
ttatcatttgaaccacaaataatgttgaaattacattatcaactaacgatacattcacca
tttcgaccatttgagggacatttgatcgaaatgaaaacgcgttcattgttaggtttcgat
ttggaacaagtgcggccacatgcgaatgattttttcaggaaagcattattcggtgatgtt
atgcttctctatccgccatcacaaattgcacttgctgctttaaaacatgctttacagatg
ctagataaggcagatgatttattgaaagatcaattcctgaataagatgcttgagatcgat
acgtggaagccgcaaaatgataatgttttaatatgcgaaaaattaattgctcggcttgat
gaaattatacaatgcgtacttgatggttgtaagcccatagcacctgaaacaaatgaagca
ttacagagtcatatggaacgttgggtaaatacttttcctgaattggaacgcagattatcc
gttttgaatgctagccttcaagaaaattctaattcgaatactgctctttctgatgatgat
tga

DBGET integrated database retrieval system