KEGG   Brugia malayi (filaria): Bm1_14350Help
Entry
Bm1_14350         CDS       T01050                                 

Definition
histone deacetylase 1 (HD1)
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
bmy  Brugia malayi (filaria)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:bmy04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 464 aa AA seqDB search
MIIGMAIQAHSKIRVAYYYDGDVGNYYYGQGHPMKPHRIRMAHNLILNYGLYRRMEVYRP
HVATFEEMTKYHSNDYLTFLKNARPEDXIDSNTAKARQRYNVGEDCPVFDGMYEFCQTSC
GGSLAAAAKLNKKQADITINWMGGLHHAKKSEASGFCYTNDIVLAILELLNHHQRVLYVD
IDVHHGDGVEEAFYTTDRVMTVSFHKFGEYFPGTGDIQDIGSGRGKYYAVNCPLHDGIDD
DTYQSIFRAVMEQVMLSYQPSAIVLQCGADSLVGDRLGCFNLSLKGHGKCVEFMKKFNLP
LLLLGGGGYTIRNVARCWAYETAIALDVEISNELPYNDYFEYYSNDFKLHIIPSNMTNLN
TPDYLQKMQSTIFEHLRHLPYAPSVQMQLLENCVEGDNEFYEEHSIKPNRNERSHNLSAE
DLSPETKRIRISSPKSPKSPKSPKSFLGSKFSKSPKYSRSTSDS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgattattggtatggctattcaggctcatagcaaaatcagggttgcatactactatgat
ggagatgttgggaattactactacggccaagggcatccgatgaagccacacagaattcgg
atggcgcataatctcattctcaattatggtctttatcgacgaatggaagtttatagaccg
catgtggcgacatttgaggaaatgacgaagtatcacagtaacgattacttaacattttta
aaaaacgcacgaccagaagataycattgatagcaatacagcgaaagctcgtcaacgatac
aatgttggcgaagattgccctgtttttgacggtatgtatgaattttgccaaacttcttgc
ggtggctctcttgccgcagcagcgaaacttaacaaaaagcaagcagatattaccataaat
tggatgggtggtttacatcatgccaagaaaagtgaagcttctggattctgctacacgaat
gatattgtcttagcaattcttgagcttctcaatcatcatcagcgtgttttatatgtcgac
attgatgtccatcatggtgatggtgtcgaagaagcattctacacaacagatcgtgtaatg
accgtttcgtttcacaaatttggtgaatattttccaggtactggagatattcaggatatc
ggctcaggtcgaggaaaatattatgctgtaaattgtccattgcatgatggtattgatgat
gacacgtatcaaagtatattcagggcagttatggagcaggttatgctgtcttaccagcca
tcagctattgtcttacagtgtggcgctgattcattagttggtgatagacttggatgtttc
aatctttctctaaaaggacatggcaagtgtgttgaattcatgaagaaattcaatttacca
cttttgttacttggtggtggcggttataccattcgtaatgttgcacgttgctgggcttat
gagacagctattgctttggatgttgaaatatcaaatgaattgccgtacaacgattatttt
gagtactactcaaatgatttcaagctccacatcatcccatcaaatatgacaaatctgaac
acacccgattatcttcaaaaaatgcagtcgacgatttttgaacatctgcggcatttacca
tacgctcccagtgtgcaaatgcaacttctagaaaactgcgtggaaggcgataacgaattt
tatgaagaacatagcataaaaccaaatcgaaatgaacgatctcataatcttagcgctgag
gatttatctccagaaacaaaacgaattcggatctcatcaccaaagtctccaaaaagtcca
aaatctcctaaatcattcttaggttcaaagttttcgaagtcycctaagtattctaggtcc
acatcagattcatga

DBGET integrated database retrieval system