KEGG   Brugia malayi (filaria): Bm1_15330Help
Entry
Bm1_15330         CDS       T01050                                 

Definition
Glycosyl hydrolase family 20, catalytic domain containing protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bmy  Brugia malayi (filaria)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bmy00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:bmy00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:bmy00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bmy00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:bmy04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 487 aa AA seqDB search
MWLFITAVLLGDILQQKFSESWPDPHLRSKGAIWPQPQYLIIGNESTTVNLDAFTFVSTV
GQCEIIDKAIIRYHKRLFGEIRRNELKKIKRQNHNKIIDNQILSNLTITVEEGCTNRFPQ
FGMDESYKLIVTSNDAVLRANQVWGVLRGMESFAQLFFDRNTKIHKVDIRDYPRFFHRGV
LLDTARHYLSVNVIKANIELMAQNKFNTFHWHIVDIESFPYQSEVIPELIKGAYTPNHIY
TISQIKDIIDYGRLRGIRVLPEFDTPGHMKSWGIGVKDLLTKCYHSNGSLYQNFENLLDP
TNSNTWDVLSALFQIYGLKDGPSIQAWYFSKFVPLLHSLKFGKNKKFLVWQEVISGANLT
INMTRNDNLIAHIWKNTRDIEYATKLGYYVILSACWYLDLITSTADWKLYYSCDPQDFNG
TEAQKHLVIGGEAALWGEWVDESNVIPRLWPRASAVAERLWSSVETKSIEKAWPRLFYIL
IKMEQMI
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtggctatttattactgcggtattgcttggcgatattttgcaacaaaaatttagtgaa
agttggcctgatccgcatctgcgttcaaaaggtgccatttggccacaaccacaatatctc
ataattggtaacgaatctacaacagttaatttagatgcgtttacttttgtatcaaccgtt
ggacagtgtgaaattattgataaagcaatcattcgttatcataaacgtttatttggtgaa
attcgacgtaatgaattaaaaaagattaaacgacaaaatcataacaaaataattgataat
cagattcttagcaatttgacaataacggtagaggaaggatgcactaatcgatttccgcaa
tttggtatggatgagagttataaattaattgttacaagcaatgatgcggttttgagagct
aatcaggtttggggcgtgttgagaggaatggaatcatttgcgcaattattttttgatagg
aataccaaaatacacaaggttgacattcgtgattatccacgtttttttcatcgtggagtg
ttattggatacagccaggcattatttatcagttaatgttattaaagcaaatattgaatta
atggcacaaaataaatttaacacatttcattggcatattgttgatatcgagtcattcccg
tatcagtctgaagtgattccagaattaatcaaaggagcttatacaccaaatcatatttat
accatatcacaaattaaggatataatagattatggtcgattacgtggtatacgtgtgcta
ccggaattcgatacaccgggacacatgaaatcatggggaattggtgtaaaagatctttta
acaaaatgttatcattcaaatggttcattatatcaaaattttgaaaatttattagatcca
acaaattcaaatacatgggatgtattaagtgcactctttcagatatatggtcttaaagat
ggtcctagcattcaagcatggtactttagcaagtttgttcctcttctccattcactgaaa
ttcggaaaaaacaagaaatttcttgtatggcaagaagtaataagtggtgcaaatttaacg
ataaatatgacaagaaatgataatctaatagcacatatttggaaaaatacaagagatatt
gaatatgcaactaaattgggttattacgttatcttatcagcttgttggtatcttgattta
atcacatcaaccgctgattggaagttatactacagctgtgatccacaggatttcaatggc
accgaagcgcaaaaacaccttgtgataggtggtgaagcagcactttggggtgaatgggta
gatgaaagtaacgtgataccacgtttatggccgcgtgcaagtgctgttgcagaacgctta
tggagttcagttgaaacaaaaagtattgaaaaagcatggccaaggttattttatatttta
attaaaatggaacaaatgatatga

DBGET integrated database retrieval system