KEGG   Brugia malayi (filaria): Bm1_15330Help
Entry
Bm1_15330         CDS       T01050                                 

Definition
(RefSeq) Glycosyl hydrolase family 20, catalytic domain containing protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
bmy  Brugia malayi (filaria)
Pathway
bmy00511  Other glycan degradation
bmy00520  Amino sugar and nucleotide sugar metabolism
bmy00531  Glycosaminoglycan degradation
bmy00604  Glycosphingolipid biosynthesis - ganglio series
bmy01100  Metabolic pathways
bmy04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bm1_15330
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Bm1_15330
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    Bm1_15330
   00604 Glycosphingolipid biosynthesis - ganglio series
    Bm1_15330
   00511 Other glycan degradation
    Bm1_15330
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Bm1_15330
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bm1_15330
Chaperones and folding catalysts [BR:bmy03110]
 Intramolecular chaperones
  Others
   Bm1_15330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 6097974
NCBI-ProteinID: XP_001894526
AA seq 487 aa AA seqDB search
MWLFITAVLLGDILQQKFSESWPDPHLRSKGAIWPQPQYLIIGNESTTVNLDAFTFVSTV
GQCEIIDKAIIRYHKRLFGEIRRNELKKIKRQNHNKIIDNQILSNLTITVEEGCTNRFPQ
FGMDESYKLIVTSNDAVLRANQVWGVLRGMESFAQLFFDRNTKIHKVDIRDYPRFFHRGV
LLDTARHYLSVNVIKANIELMAQNKFNTFHWHIVDIESFPYQSEVIPELIKGAYTPNHIY
TISQIKDIIDYGRLRGIRVLPEFDTPGHMKSWGIGVKDLLTKCYHSNGSLYQNFENLLDP
TNSNTWDVLSALFQIYGLKDGPSIQAWYFSKFVPLLHSLKFGKNKKFLVWQEVISGANLT
INMTRNDNLIAHIWKNTRDIEYATKLGYYVILSACWYLDLITSTADWKLYYSCDPQDFNG
TEAQKHLVIGGEAALWGEWVDESNVIPRLWPRASAVAERLWSSVETKSIEKAWPRLFYIL
IKMEQMI
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtggctatttattactgcggtattgcttggcgatattttgcaacaaaaatttagtgaa
agttggcctgatccgcatctgcgttcaaaaggtgccatttggccacaaccacaatatctc
ataattggtaacgaatctacaacagttaatttagatgcgtttacttttgtatcaaccgtt
ggacagtgtgaaattattgataaagcaatcattcgttatcataaacgtttatttggtgaa
attcgacgtaatgaattaaaaaagattaaacgacaaaatcataacaaaataattgataat
cagattcttagcaatttgacaataacggtagaggaaggatgcactaatcgatttccgcaa
tttggtatggatgagagttataaattaattgttacaagcaatgatgcggttttgagagct
aatcaggtttggggcgtgttgagaggaatggaatcatttgcgcaattattttttgatagg
aataccaaaatacacaaggttgacattcgtgattatccacgtttttttcatcgtggagtg
ttattggatacagccaggcattatttatcagttaatgttattaaagcaaatattgaatta
atggcacaaaataaatttaacacatttcattggcatattgttgatatcgagtcattcccg
tatcagtctgaagtgattccagaattaatcaaaggagcttatacaccaaatcatatttat
accatatcacaaattaaggatataatagattatggtcgattacgtggtatacgtgtgcta
ccggaattcgatacaccgggacacatgaaatcatggggaattggtgtaaaagatctttta
acaaaatgttatcattcaaatggttcattatatcaaaattttgaaaatttattagatcca
acaaattcaaatacatgggatgtattaagtgcactctttcagatatatggtcttaaagat
ggtcctagcattcaagcatggtactttagcaagtttgttcctcttctccattcactgaaa
ttcggaaaaaacaagaaatttcttgtatggcaagaagtaataagtggtgcaaatttaacg
ataaatatgacaagaaatgataatctaatagcacatatttggaaaaatacaagagatatt
gaatatgcaactaaattgggttattacgttatcttatcagcttgttggtatcttgattta
atcacatcaaccgctgattggaagttatactacagctgtgatccacaggatttcaatggc
accgaagcgcaaaaacaccttgtgataggtggtgaagcagcactttggggtgaatgggta
gatgaaagtaacgtgataccacgtttatggccgcgtgcaagtgctgttgcagaacgctta
tggagttcagttgaaacaaaaagtattgaaaaagcatggccaaggttattttatatttta
attaaaatggaacaaatgatatga

DBGET integrated database retrieval system