KEGG   Brugia malayi (filaria): Bm1_15415Help
Entry
Bm1_15415         CDS       T01050                                 

Definition
serine/threonine-protein kinase 6 (EC:2.7.11.1)
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
bmy  Brugia malayi (filaria)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 279 aa AA seqDB search
MDKQSTSSVDNTTTTTATTVTTTTAITATNLMYTVSNVRPKIRQWSLDDFEIGRALGKGR
FGNVYLAREIESRFVVALKVVYKSQLEQNNLRRQLRREIEIQYHLRHPNILRLYGYFHDD
DRVYLVLEFAPKGNLFQHLQVMKTFPPELAAKYMYQLASAMEYCQQKKVLHRDLKPENVL
ISAKNNLKISDFGWSVHEPSSRRNTVCGTLDYLAPEMAPEKTHDSKVDNWSLGVMLYEFL
VGKPAFEAVTAELTLINIHNCRYTIPDSVPNGAKDLISR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggataaacaatcaacaagtagtgttgacaatactactactactactgccactacggtt
actactactactgctattactgccactaatttgatgtatactgttagtaatgtaagacca
aagattcgtcagtggtcattggatgattttgaaattggtcgagcattgggtaagggtaga
tttgggaatgtgtatttggctcgagaaattgaatcaaggtttgtggttgctcttaaagtt
gtatacaaatcacaattggagcaaaataatttgagacgacaattacgacgcgaaattgaa
attcagtatcacttaagacatcccaatattcttcggttatatggttattttcacgacgat
gatcgcgtttatttggtgttagaatttgcgcctaaaggaaatctgttccaacatcttcaa
gtgatgaaaacatttccacctgaattagctgctaaatatatgtatcagttggcatcagct
atggaatattgtcaacaaaagaaagttttacatcgagatttgaaacctgaaaatgtttta
ataagtgcaaaaaataatttgaaaatatcagattttggatggtcagtacatgaaccatca
tcaagacgaaacactgtatgcggtacgttggattatttggcacctgaaatggcacctgaa
aagacgcatgattctaaagttgataattggtcattaggtgttatgctatatgaattttta
gttggtaaacctgcatttgaagccgtgacagcggaacttaccttaatcaatattcacaat
tgtagatatacaataccggatagtgtaccaaatggtgcaaaagatctcatatcacgc

DBGET integrated database retrieval system