KEGG   Brugia malayi (filaria): Bm1_15415Help
Entry
Bm1_15415         CDS       T01050                                 

Definition
serine/threonine-protein kinase 6 (EC:2.7.11.1)
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Bm1_15415
Protein kinases [BR:bmy01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   Bm1_15415
Protein phosphatases and associated proteins [BR:bmy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Bm1_15415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 279 aa AA seqDB search
MDKQSTSSVDNTTTTTATTVTTTTAITATNLMYTVSNVRPKIRQWSLDDFEIGRALGKGR
FGNVYLAREIESRFVVALKVVYKSQLEQNNLRRQLRREIEIQYHLRHPNILRLYGYFHDD
DRVYLVLEFAPKGNLFQHLQVMKTFPPELAAKYMYQLASAMEYCQQKKVLHRDLKPENVL
ISAKNNLKISDFGWSVHEPSSRRNTVCGTLDYLAPEMAPEKTHDSKVDNWSLGVMLYEFL
VGKPAFEAVTAELTLINIHNCRYTIPDSVPNGAKDLISR
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggataaacaatcaacaagtagtgttgacaatactactactactactgccactacggtt
actactactactgctattactgccactaatttgatgtatactgttagtaatgtaagacca
aagattcgtcagtggtcattggatgattttgaaattggtcgagcattgggtaagggtaga
tttgggaatgtgtatttggctcgagaaattgaatcaaggtttgtggttgctcttaaagtt
gtatacaaatcacaattggagcaaaataatttgagacgacaattacgacgcgaaattgaa
attcagtatcacttaagacatcccaatattcttcggttatatggttattttcacgacgat
gatcgcgtttatttggtgttagaatttgcgcctaaaggaaatctgttccaacatcttcaa
gtgatgaaaacatttccacctgaattagctgctaaatatatgtatcagttggcatcagct
atggaatattgtcaacaaaagaaagttttacatcgagatttgaaacctgaaaatgtttta
ataagtgcaaaaaataatttgaaaatatcagattttggatggtcagtacatgaaccatca
tcaagacgaaacactgtatgcggtacgttggattatttggcacctgaaatggcacctgaa
aagacgcatgattctaaagttgataattggtcattaggtgttatgctatatgaattttta
gttggtaaacctgcatttgaagccgtgacagcggaacttaccttaatcaatattcacaat
tgtagatatacaataccggatagtgtaccaaatggtgcaaaagatctcatatcacgc

DBGET integrated database retrieval system