KEGG   Brugia malayi (filaria): Bm1_15795Help
Entry
Bm1_15795         CDS       T01050                                 

Definition
Filamin/ABP280 repeat family protein
Orthology
K04437  
filamin
Organism
bmy  Brugia malayi (filaria)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    Bm1_15795
Exosome [BR:bmy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Bm1_15795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
AA seq 2174 aa AA seqDB search
MVLEDRQPDAEWKKIQQNTFTRWVNQKLEPINVEVTDLETDFEEGLKLIRLVEVLSGRSL
GRYSKKVTFRHQKLENISLALKFLENEEHIKIVNIDSSAIADRNLKLILGLVWTLILHYS
ISKQVWDDHTGSTTKGEDVSPKTKLMTWLKGKLPTGLPFTNFTSDWNDGILLGALVDSCA
PDLGVDWRNWLPSQALHSTRTAMNLAKDYLNIAPLIAPEELISPAVDERSVMTYLSQFPG
AKYTPRMGRFHNIDVMPIVGVNTKFTFLTSNAFMLPEVNIKGPAESLVPYNMSRLSETVY
NFIYQPEIAGEYQIMAVVRDEVSGNFAQLASPKITAVEGAHLLYDRNVQHGMPVKFRVEN
AGNDPIEVLVAPPYDKGFMVPVIPDGNTFKGEFIPKREGVYELDVFQKGDRIAGSPFSLT
VIPQAQINIWGRGLEPHGIQSGEEVIVYADYSGSLLGPPHMRVHQLSGKEISVSETIDEN
LHLKIFKYRPQDVGIYEVDILLDGKHIDESPYKIMISPVSDSKVRAFGPGLESGVANLPS
IFLIETNGGRFEQIDIAVSGRTLTAENVSKKPDIELVDNKNGSAVARFTPAVPGIYTVKV
CYAGEHVKGSPFIVQVQPANNNLKIADMRLSGIKSDVTALQGEDLIFWIEMPDTRVRLKP
LVRALDEKYEEVPIQVVETKSGQYECRFVPLALGRYYFLLSVGGVAIPGSPFVVVVREII
DPSKIRIYGIGIGPNIHANRLVSFVIDPQKVGTVERFDSKLHHENGTPVNVALIDNGDET
LIASYTPHEAGLHKLALYYDDMELLKMNINVKPIDISSIVIDGLNNETVVIGHREDIVID
IGDLMSMKNGVEVIVEEANGSKYMVPLENGYDSTIFKGSWIAKNVGKTKFSVFFDEYLVY
ESQIIVRRKQDATKCRVTGDGLRRGIVGIPANFQVDMKDAGGDRMKMAIKGPSESKTNII
DHSDGLCTVEYTAQTPGLYEISIFFGDNEEEIPGSPFMVLVDYEYDPSKILITGYNNGHV
RAGVPTSFLIDATRTAIEPISVRFPIGFQQPFIEEIESRIYRVTFTPNARAGEILPLEVL
YGGQLLYGRPWEFTVEQDEREFIALKNDSGILPHEVRASLRCELLVEGKKAEKISNIKAE
IKGPDNKPRKSSLTETPNKGIYLLGFVPDMAGTYLITIYGDGKPLHSKPYEITAVPIGSA
NKCYLELKPLDKFWIIEEPKTFKVNANCAGEGALNIVSDRDDLKVNVVKQNDGCYLVTFT
PHHGGPHQITLLYGGVEIPNGTFSFECGPAVASEPEVALLKREADPEQCFYNVEKHLIPH
TFRFSVTPDSHSDKLSASVRMPSGKKDVAHIKDNADGTITVTYHPKQCGNHLLSVQHDGV
NMSGSPISFYVSSANDGYVTVYGPGLTRAVVGEPAPFTVCAKGSPAKELAVAVEGAAKAT
IKCHDNKDGTCSVAWVPPVPGEYKVHVKLSGNPVKGSPFVVIVAGEGQKRAHLSVGSTSE
VSLNVATTEVKGLSASIKSPSGIEEPCFIRQIDSANIGVSFTPREEGEHLVTVKKNGQII
PKSPFRVKVDKNQVGNASKVTVSGNGKANAISQQYNDVIVDTRNAGYGGLSVSVEGPSKA
ELKCTEAKEGLINVAYKPTEPGIYILSIKFADTHVKDSPFTVNCTGKGLGSVKKRATKKV
NQAPMILPNQDASIYLKLENTSPMETTAKVMNPDGKSSDIEVRDTGDSLYQIIFKPEMDG
SHAISVFNKGQHVLGSPFQFTVGHITEVGAHKVRAAGVGILRGETNMKQSFNVYSREAGQ
GELEVTVEGPSEAELQFQDHKDGNCHFNYKVSKPGEYLISIKFNNQHITDSPFKVFVAPA
TGEARRLELASFPDSGLPGKACTFTVLTHRAAGHLEAKVHTPSNKIETIDIVPIDEGESY
ALRFIPTETGSYYIDVTLDGAPMRDSPFRLRVGANEDSDPTAVTVSGDGIHGGETGHKCE
FIINTCNAGSGVLLVQIDGPSKVTLDAYELEMGYKVRYMALAPGAYFVDIKYAGVHIPCS
PFKVVMTGKELGGGGEPDTSLIKIDALAKTSKGTVAQVPVLKGDASKVTVKGGGLNKFFP
GRPAVFNIDTALAGENLLFVGILTSKGPCEEVTVRHLGGGRYVVTYRIQERVKGFIFVKY
GETNVPGSPFAVSF
NT seq 6525 nt NT seq  +upstreamnt  +downstreamnt
atggttctagaagatcggcaaccagatgcagagtggaaaaaaatccagcagaatactttc
acacgatgggttaatcagaagttggaaccaataaatgttgaagtcactgatttggaaact
gactttgaagaaggtttaaaattaattcgtttggtggaagtattatcaggaagatctctt
ggtcgatacagtaaaaaggtcacttttcgccatcagaagttagaaaatatatcgcttgcg
ctaaaattcctggaaaatgaggaacatattaaaattgttaatatcgatagttcagcaata
gcagatcgcaatttgaagctcattttgggtctagtttggacacttattttacattattct
atctcaaaacaggtctgggatgaccatacaggcagtacaacaaaaggtgaagatgtatca
ccaaaaacaaaacttatgacttggcttaagggaaaattaccaactggactcccttttacc
aacttcacatccgattggaatgatggaattcttcttggtgctttggttgattcttgtgca
cctgatttgggagtagattggcgcaattggttaccatcgcaggctttacattcaactcgt
acagcaatgaaccttgcaaaggattaccttaacatcgctcctctaattgcaccagaagaa
ttaatcagtccagctgttgacgagcgaagtgtgatgacatatctttcacaatttcccgga
gcaaaatatacgccacgaatgggtcgatttcataatattgatgtgatgccaattgttgga
gtcaatacgaaatttacttttttaaccagtaacgcatttatgcttccagaagtaaacatt
aaagggccagcggaatcattggtaccctacaacatgagccgactttcagaaaccgtgtat
aatttcatttatcaaccggaaattgccggtgaatatcagattatggcagtagttcgtgac
gaggtatcgggtaacttcgctcagttggcaagtcctaaaataacagcagttgaaggagca
catttgttatatgacagaaacgtacaacatggcatgccagttaaattcagggtagaaaat
gcagggaacgatccgattgaggttttggtagccccaccatacgataagggatttatggta
ccggtgatacctgatggtaatactttcaaaggtgaattcataccaaaacgagaaggtgtg
tatgaattggacgttttccaaaaaggagaccgcattgctggtagtcccttctcactcaca
gtaattccacaagcacaaattaacatttggggtagaggtctcgaaccacatggtattcag
agtggcgaagaagtaatcgtctatgcagattacagcggtagcttattgggacctccacat
atgcgagttcatcaactgtctggaaaagaaatatcggtgagtgaaactatagatgaaaat
ttgcacctaaaaatttttaaatatcggccacaggatgttggtatttacgaagttgatata
cttctggatgggaagcacatcgatgaaagcccgtataagataatgatatcaccggtaagt
gattcaaaagtacgagcatttggaccagggctagaaagtggtgttgcaaatttgccaagc
atcttccttatcgaaacaaacggtggtcgttttgaacagattgatattgctgttagtggg
agaacattgacagcagaaaatgtttccaagaaaccggatatagaattggtagataataag
aatggatctgctgttgctcgattcactcctgctgtacccggcatttatacagtgaaggta
tgttacgctggtgagcatgtcaaaggttcaccatttatcgtacaagtgcagccagctaat
aataatcttaaaattgctgacatgcggttatctggtatcaaatcagacgtcactgctcta
cagggcgaagatttaatattctggatcgaaatgcctgacacaagagtgcgtcttaaacca
ttagtaagagcactggacgaaaaatatgaagaagtgccaatacaggtagtggaaactaaa
tctggacagtatgaatgtcgttttgttccactagcacttggtcgatactattttcttcta
tcggttggcggtgttgcaataccaggatcaccatttgtggtagtagttcgagaaataatt
gatccaagcaaaattcgaatttatggtattggtattggaccgaatattcatgcaaatcga
ttagtaagctttgtcattgatccacaaaaagttggtactgtcgaaagatttgactcgaaa
ttgcatcatgaaaatggaacaccggtgaacgtggctttgatcgataatggagatgaaaca
cttatagcgagttataccccccatgaagctggtctgcataagttggcattatattatgac
gatatggaattattgaaaatgaacatcaatgttaaaccaattgatatttcatcgattgtg
atagatggtctaaataatgagaccgttgtaattggacatcgagaagatattgttattgat
attggggatttaatgtctatgaaaaatggtgtcgaagttattgtagaagaagctaatgga
tcgaaatatatggttcctcttgagaatggttatgattcaactattttcaaaggctcctgg
atagccaaaaatgttggcaaaacaaaattttctgttttctttgatgaatatttggtttac
gaatcgcaaattatcgttcgacgaaaacaagatgctactaagtgccgagttactggtgat
ggacttaggcgtggaatagttggtataccggcaaattttcaggtggatatgaaggatgct
ggaggagacaggatgaaaatggctatcaagggaccatcagaatcaaaaacaaacatcatt
gatcattccgatggcttatgcactgtagaatatactgcacaaacacctggtctatacgaa
ataagcattttttttggtgataatgaagaagaaattcccggttcaccctttatggtatta
gttgattatgaatatgatccgtcgaaaatcttgataaccggatataataatggacatgta
cgagctggtgtacctacgtcattcttgattgatgctacacgtaccgctatagaacctatc
agtgtacgatttcctattggctttcagcaaccatttattgaagaaattgaatctcgaata
tatcgagtaacatttacgccgaatgccagagcaggtgaaatattgcccttggaagtccta
tacggtggtcaacttctctatggaaggccatgggaatttactgttgagcaagacgaacga
gaattcatagcgctaaagaatgattccggcattctaccacatgaagtacgtgcttctctt
cgatgtgaattgttagttgaaggaaagaaagctgaaaaaattagcaacataaaggccgaa
ataaaaggtcccgataataagcctcgaaaatcatcgctcactgagacaccaaataaagga
atatatctgttgggattcgtcccggatatggctggaacataccttattactatatatggt
gatgggaagccgctccattcaaagccatatgagatcactgctgttccaattggttccgca
aacaagtgctatttagaattaaaaccgctcgataaattttggattattgaagaaccgaaa
acattcaaagtaaatgcaaactgtgcaggcgaaggtgcactaaatattgtctccgataga
gatgatttaaaagtaaacgttgtgaaacaaaatgatggctgttatttagtaacatttact
ccacatcatggaggaccgcatcaaattacactgttgtacggtggtgttgaaatacctaat
ggaacgttcagttttgaatgtggaccagctgttgctagcgaacctgaagtagcattatta
aaacgcgaagcagatccggagcagtgtttttacaacgtagagaaacatttgataccacat
acttttcgtttttcagtaactccagatagtcattctgacaaactaagtgcatcagtaaga
atgccgtccggtaaaaaagatgttgcgcatatcaaggataacgctgacggaactataacg
gtgacatatcacccaaaacagtgcggcaatcatcttctatcagtgcagcatgatggagtt
aatatgtctggaagtccaatctctttctacgttagcagtgcaaatgatggatatgtgact
gtatatggtcctggcttaacacgtgcagtggttggtgaaccagcaccatttacagtttgc
gccaagggttcaccagctaaagaattggcagttgctgttgaaggagctgcaaaagcaaca
attaaatgtcatgataataaagatggtacatgttctgtagcatgggtaccacctgtacct
ggtgaatataaggtacatgtcaaactttctggaaatccggtgaaaggttcaccgttcgtt
gtcattgtggctggtgagggccagaaacgtgcccatttatcagttggatcaacatcggag
gtttcactaaatgttgcaactacggaagtcaaaggactgtcagcttcaataaaaagtcct
agtggtattgaagaaccgtgttttattcgtcaaattgattctgctaacattggtgtttca
tttactcctcgtgaagagggtgaacatctggttactgttaaaaaaaatggtcaaatcata
ccaaaatcacctttccgagttaaagtcgataaaaatcaagtcgggaatgcgtcgaaagtt
actgttagcggtaatggaaaagcgaacgctatttctcagcagtacaacgatgtgattgta
gatacgcgtaatgcaggttatggtggtctgtctgtatctgttgaagggccatcaaaagct
gaactaaaatgtactgaagcaaaagaaggtttaattaatgtcgcctacaaaccgacggaa
ccagggatttacattttatccataaaatttgcagatacacatgtaaaagatagtccattt
accgttaactgtactggtaagggattgggatctgtgaagaaaagagccaccaaaaaagtg
aatcaggcacccatgattctgcccaatcaggatgcttccatatatttgaaattagaaaat
acatctccaatggaaacaacagcaaaagttatgaatcctgatgggaaaagctctgatata
gaagtgcgtgacactggtgatagcctttaccaaattattttcaagcctgaaatggatggt
tctcatgcaatttctgtctttaataaagggcagcatgttttaggaagtccatttcaattt
actgttggacatataacagaggtaggagcacataaagtgcgtgcagcaggagttggaata
ctacgaggagaaacaaacatgaagcagtcatttaatgtttacagcagagaagctggacaa
ggagaacttgaagtgacagtggaaggaccgtcggaagccgaactacaatttcaagaccat
aaggatggaaattgccattttaattacaaagttagcaaacctggagagtacttgataagt
attaaatttaacaaccaacacataacggattcaccatttaaagtgttcgtggctcccgca
acgggagaagctcgccggcttgagttagcgtcattcccagattctggattgcctggtaaa
gcatgcaccttcacggtacttacgcatcgtgcagcaggtcatcttgaagcgaaagttcat
acaccgagtaataagattgaaacaattgatattgttcctattgatgaaggcgaatcgtac
gctttacgattcatccctacagagacagggagttattatattgatgtgacacttgatggc
gcaccaatgcgtgattcacccttccgtttacgtgtcggtgcgaatgaggacagtgatcca
actgcagtaacagtaagtggtgatggtatacatggtggagaaactggccataagtgcgaa
ttcatcattaatacttgtaatgctgggagcggagttctgctggttcagattgatggtcca
tcgaaggttactttggacgcgtatgagctggaaatgggttataaagtacgatacatggct
ttggcacctggagcgtattttgtagatatcaaatatgcaggtgttcatatcccttgttca
ccgttcaaggtagttatgactggtaaagaacttggtggtggtggtgagccggacacttcg
cttattaagattgatgcactggcaaagacaagcaaagggactgttgcacaggttccagta
ttgaaaggtgatgcaagcaaagttactgttaaagggggtggtttgaacaaatttttccca
ggtcgaccagctgttttcaacattgatactgctcttgcgggtgaaaatcttctgttcgtt
ggtattcttacatcaaaaggaccatgtgaagaggttacagtccgacatctaggcggtggt
cgatatgtggttacttatcgtattcaggaaagggtcaaaggattcatttttgtcaaatat
ggcgaaactaatgtgccaggctcgccatttgcggtttcattctaa

DBGET integrated database retrieval system