KEGG   Brugia malayi (filaria): Bm1_15905Help
Entry
Bm1_15905         CDS       T01050                                 

Definition
histone deacetylase 11
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Bm1_15905
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 380 aa AA seqDB search
MAEERFIDNSDRSSIEKPLADRQLTAVKASKLYKEIERGQLPIVYHPVYNISFCGIERCH
PFDSRKWGRVYETLLQSGMFEENQTIRPLEASMDDLRVVHSSTYLSSLCCPCYVAKMVEV
TPVALIPPCIINKVLLKPFRYHTDKFDEHTSIYVFIIVHDYANCQLVFNACGTILAAKLA
LTSGWAINIGGGFHHASRSKGGGFCIYADITLALTFLFSNQLISKAMIVDLDAHQGNGHE
NDFSGDSRVYILDMFNXRIYPHDLRARRAIRRSIHLXVGTQDSEYLSLLSNNLEDVLNEF
QPDIIVYNAGTDCLQGDPLGLLSISSKGIRKRDEIVFKMARDRHIPVVMLLSGGYMPNTH
EVIAKSILNLYDKNLLRIEL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggaaagattcattgataatagcgatcgaagctccatcgaaaaaccactggca
gacagacaattaaccgctgtgaaagcatcaaagttatacaaggaaattgaacgaggtcaa
ttacccattgtatatcatccagtttataatatatcattttgtgggatcgaacggtgccat
ccatttgattcacgtaaatggggacgtgtttatgagacattgttgcaatcagggatgttt
gaagaaaatcaaacaataaggccactggaagcaagtatggacgatttacgtgttgtgcat
tcatccacctatctctcatcattatgctgtccatgttatgttgcaaaaatggttgaagtt
acacctgttgcacttattcctccatgtattatcaacaaagttcttttgaagcctttccga
tatcatactgataagtttgatgaacatacatcgatatatgtttttattatagtgcacgat
tatgctaactgtcaattagtgttcaatgcatgcggcacaatattggcagccaagcttgca
ctaacatccggttgggcaataaatattggtggtggtttccatcatgcaagtcgttcaaag
ggtggaggtttttgtatttatgctgatatcaccttggcactaacattcttattctcgaat
caattgatttcaaaagcaatgattgttgatttagatgctcatcagggtaatggtcatgaa
aatgatttcagcggtgacagtcgcgtttatatattggatatgtttaacartcgtatttat
ccgcatgatctgagagcaagacgtgctataaggagatcaattcatcttcrtgttggtaca
caggattcagaatatctctccttactttcaaataatcttgaagatgtcttgaacgaattt
cagcctgatataatcgtgtataatgcgggaactgattgtcttcaaggtgatccacttggg
ttattgtcgatatcctcgaagggaattcgaaaacgtgatgaaattgttttcaaaatggct
cgtgacagacatatcccagtcgtaatgttacttagtggtggatatatgccgaatacgcat
gaagtcattgccaagtcaatcttgaatttgtacgataaaaatttattaaggatagaactg
taa

DBGET integrated database retrieval system