KEGG   Brugia malayi (filaria): Bm1_16975Help
Entry
Bm1_16975         CDS       T01050                                 

Definition
(RefSeq) transcriptional regulator, Sir2 family protein
  KO
K11416  mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     Bm1_16975
Chromosome and associated proteins [BR:bmy03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     Bm1_16975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SIR2 TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 6098302
NCBI-ProteinID: XP_001894852
UniProt: A0A0H5SD54
AA seq 306 aa AA seqDB search
MAMSYAKALSPYDNKGVLGLPEIIDDHNELKRKVGKLAELLLASRCCVLHTGAGISTTAG
IPDFRGPKGLWTLEARNEPVDDGVSFVEASPTYTHYGINALESRNIVKFVITQNVDGLHI
RSGYPLNRIAELHGNVFLEKCSRCSRRYYRTTPTGSIGLKPTGKRCEGTNSGRPCRGMLH
DVCLDWEDPLPQEDLYAANEFARNADLSICMGTTLQITPAGDLPLLAKKNGGKMVIINLS
KTKHDEKADLIINARVDDVMRMLLTTMDIGVVQKFNTNFVVPLSIHPLERFRKNRKRRKL
KKEKEE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctatgagctatgcgaaagctttgtcgccgtacgacaataagggtgttctaggattg
cctgagattatcgatgatcataatgaactgaaacgaaaagtgggcaagcttgcagagtta
ctattggcaagtcgttgttgtgtgctacatacaggagctggtatcagtactacagcaggt
ataccagatttccgcggtcctaaaggattgtggactttggaagctcggaacgaaccagtt
gatgatggagttagttttgttgaagcttctccaacttatactcattacggaattaacgca
ctggaaagcagaaatatcgtcaaatttgttattacccagaatgtagatggtttgcacatt
cgttcaggatatccgttgaatcgtatcgctgaacttcatggaaatgtattcctggaaaaa
tgttccagatgtagcagaagatattatcggactacgccaactggaagcatcggtttaaaa
cctaccgggaaacgatgtgaaggtacaaatagcgggcggccttgtcgtggaatgctgcat
gacgtttgtttggactgggaagatccattaccacaagaagatctttatgcagctaatgaa
ttcgcaagaaatgccgatctcagcatttgcatgggtacaacactccaaataactcctgct
ggtgatctaccacttctagccaagaaaaatggtggtaaaatggtcatcattaatctttca
aaaacaaaacatgatgagaaagccgatctcataattaatgctcgtgtggatgatgtgatg
cgaatgttgttgaccacaatggatattggtgttgtgcagaaatttaatactaattttgtt
gtacctctttctatccatccgctggagaggttcagaaaaaacagaaagcgacggaaactg
aagaaggagaaggaggaatga

DBGET integrated database retrieval system