KEGG   Brugia malayi (filaria): Bm1_16975Help
Entry
Bm1_16975         CDS       T01050                                 

Definition
transcriptional regulator, Sir2 family protein
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     Bm1_16975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 306 aa AA seqDB search
MAMSYAKALSPYDNKGVLGLPEIIDDHNELKRKVGKLAELLLASRCCVLHTGAGISTTAG
IPDFRGPKGLWTLEARNEPVDDGVSFVEASPTYTHYGINALESRNIVKFVITQNVDGLHI
RSGYPLNRIAELHGNVFLEKCSRCSRRYYRTTPTGSIGLKPTGKRCEGTNSGRPCRGMLH
DVCLDWEDPLPQEDLYAANEFARNADLSICMGTTLQITPAGDLPLLAKKNGGKMVIINLS
KTKHDEKADLIINARVDDVMRMLLTTMDIGVVQKFNTNFVVPLSIHPLERFRKNRKRRKL
KKEKEE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctatgagctatgcgaaagctttgtcgccgtacgacaataagggtgttctaggattg
cctgagattatcgatgatcataatgaactgaaacgaaaagtgggcaagcttgcagagtta
ctattggcaagtcgttgttgtgtgctacatacaggagctggtatcagtactacagcaggt
ataccagatttccgcggtcctaaaggattgtggactttggaagctcggaacgaaccagtt
gatgatggagttagttttgttgaagcttctccaacttatactcattacggaattaacgca
ctggaaagcagaaatatcgtcaaatttgttattacccagaatgtagatggtttgcacatt
cgttcaggatatccgttgaatcgtatcgctgaacttcatggaaatgtattcctggaaaaa
tgttccagatgtagcagaagatattatcggactacgccaactggaagcatcggtttaaaa
cctaccgggaaacgatgtgaaggtacaaatagcgggcggccttgtcgtggaatgctgcat
gacgtttgtttggactgggaagatccattaccacaagaagatctttatgcagctaatgaa
ttcgcaagaaatgccgatctcagcatttgcatgggtacaacactccaaataactcctgct
ggtgatctaccacttctagccaagaaaaatggtggtaaaatggtcatcattaatctttca
aaaacaaaacatgatgagaaagccgatctcataattaatgctcgtgtggatgatgtgatg
cgaatgttgttgaccacaatggatattggtgttgtgcagaaatttaatactaattttgtt
gtacctctttctatccatccgctggagaggttcagaaaaaacagaaagcgacggaaactg
aagaaggagaaggaggaatga

DBGET integrated database retrieval system