KEGG   Brugia malayi (filaria): Bm1_17020Help
Entry
Bm1_17020         CDS       T01050                                 

Definition
hypothetical protein
Organism
bmy  Brugia malayi (filaria)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 652 aa AA seqDB search
MSPPIEAHTSPPFTMHSSLPIAQPNSGLPQTLSLSAAQPGSSLSLPVSAAQPSSALPHNL
PVNAAQPGLPQNLPVDAAQPGLPQSLPVSAAQPSSALPHNLPVNAAQPGLPQNLPVDAAQ
PGLPQSLPVSAAQPSSALPHNLPVDAAQPGLPQSLPVNAAQPRLPQNLLVSAAQPSSGLP
QSLSVSAAQPGLPQSLPVNAAQPGLPQSLPVNAAQPRLPQNLPVNAAQPGLPQSLPVNAA
QPRLPQNLSVSAAQPGLPQSLPVNAAQPRLPQNLSVSAAQPGLPQSLPVSAAQPSSALPH
NLPVDAAQPGLPQSLPVSAAQPSSALPHNLPVDAAQPGLPQSLPVSAAQPRLPQNLLVSA
AQPSSGLPQSLSVSAAQPGLPQSLPVNAAQPGLPQSLPVNAAQPRLPQNLPVNAAQPGLP
QSLPVNAAQPDSNLSVSAAQSGPVLLQSLPVNAAQPGLPQSLPVNAAQPRLPQNLSVSAA
QPGLPQSLPVNVAQPGLPQSLPVNAAQPRLPQNLPVNAAQPGLPQSLPVNAAQPRLPQNL
LVSAAQPSSGLPQSLSVSAAQPGLPQSLPVNAAQPGLAQSLPVNAAQPDSNLSVSAAQPG
SGLPQSLSVGAAPPGFLPPNDEVVAQLNDAQNFRALAKLMQLKQHFTRDSTN
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctccaatagaggctcatacttcaccgccatttactatgcactcgtcacttccc
attgcgcaaccgaactcaggtttaccacagactttatcactcagcgccgcgcaaccaggc
tcaagtttaagtttaccagtcagtgctgcacaaccgagctcagctttaccacataattta
ccagtcaatgctgcgcaaccggggttgccacaaaatttaccagtcgacgctgcgcaaccg
ggattaccacaaagtttaccagtcagtgctgcacaaccgagctcagctttaccacataat
ttaccagtcaatgctgcgcaaccggggttgccacaaaatttaccagtcgacgctgcgcaa
ccgggattaccacaaagtttaccagtcagtgctgcacaaccgagctcagctttaccacac
aatttaccagtcgacgctgcgcaaccgggattaccacaaagtttaccagtcaacgctgcg
caaccgaggttaccacaaaatttattagtcagtgctgcgcaaccgagctcaggtttacca
caaagtttatcagtcagtgctgcgcaaccgggattaccacaaagtttaccagtcaacgct
gcgcagccgggattaccacaaagtttaccagtcaacgctgcgcaaccgaggttgccacag
aatttaccagtcaacgctgcgcagccgggattaccacaaagtttaccagtcaacgctgcg
caaccgaggttaccacaaaatttatcagtcagtgctgcgcaaccgggattaccacaaagt
ttaccagtcaacgctgcgcaaccgaggttaccacaaaatttatcagtcagtgctgcacaa
ccgggattaccacaaagtttaccagtcagtgctgcacaaccgagctcagctttaccacac
aatttaccagtcgacgctgcgcaaccgggattaccacaaagtttaccagtcagtgctgca
caaccgagctcagctttaccacacaatttaccagtcgacgctgcgcaaccgggattacca
caaagtttaccagtcagtgctgcacaaccgaggttaccacaaaatttattagtcagtgct
gcgcaaccgagctcaggtttaccacaaagtttatcagtcagtgctgcgcaaccgggatta
ccacaaagtttaccagtcaacgctgcgcagccgggattaccacaaagtttaccagtcaac
gctgcgcaaccgaggttgccacagaatttaccagtcaacgctgcgcaaccgggattacca
caaagtttaccagtcaacgctgcgcaaccagattcaaatttatcagttagtgctgcacaa
tcgggcccagttttactacaaagtttaccagtcaacgctgcgcaaccgggattaccacaa
agtttaccagtcaacgctgcgcaaccgaggttaccacaaaatttatcagtcagtgctgcg
caaccgggattaccacaaagtttaccagtcaacgttgcgcagccgggattaccacaaagt
ttaccagtcaacgctgcgcaaccgaggttgccacagaatttaccagtcaacgctgcgcaa
ccgggattaccacaaagtttaccagtcaacgctgcgcaaccgaggttaccacaaaattta
ttagtcagtgctgcgcaaccgagctcaggtttaccacaaagtttatcagtcagtgctgcg
caaccgggattaccacaaagtttaccagtcaacgctgcgcaaccgggattagcacaaagt
ttaccagtcaacgctgcgcaaccagattcaaatttatcagttagtgctgcacaaccgggc
tcaggtttaccacaaagtttatcagtcggtgctgcaccacctggtttcttaccaccaaat
gatgaagtggttgcgcaattgaacgatgctcaaaatttccgtgctttagcaaaacttatg
caacttaaacaacattttactagagatagtacgaattaa

DBGET integrated database retrieval system