KEGG   Brugia malayi (filaria): Bm1_19675Help
Entry
Bm1_19675         CDS       T01050                                 

Definition
Serine/threonine protein phosphatase F56C9.1 in chromosomeIII
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
bmy  Brugia malayi (filaria)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    Bm1_19675
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Bm1_19675
Protein phosphatases and associated proteins [BR:bmy01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     Bm1_19675
Transcription machinery [BR:bmy03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     Bm1_19675
Spliceosome [BR:bmy03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    Bm1_19675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 331 aa AA seqDB search
MAAEAEKLNLDNIIARLLEVRGSKPGKNVQLTENEIKGLCIKSREIFLSQPILLELEAPL
KICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFF
LLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPD
LQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVTGWGENDRGVSFTFGPEVVAKFLHKH
DLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGSMMTVDETLMCSFQILKPA
DKKKFPYSGVGSGRPVTPPRTPAPNAKKGKK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgaggctgagaagcttaatctggacaatatcatcgctaggcttctagaagta
cgtggttcgaagccaggcaaaaatgtacagctgacagaaaatgagattaaaggcctttgc
atcaaatcacgtgaaatatttcttagccagccgatcttgttagaactcgaggcgcctcta
aaaatttgcggtgatgtgcatgggcagtattatgatctgctgcgactttttgaatatggt
ggttttccgcccgaatcaaattatctctttcttggggactatgtagatagaggtaaacaa
tcgcttgaaacaatctgtttactgttggcttataagataaaatatcccgaaaactttttc
ctcttgcgcggaaaccatgaatgcgcttctattaacaggatatatggtttctacgatgag
tgtaaacggcgttacaatatcaaactgtggaaaacttttactgattgtttcaattgtttg
ccagtggcagcaataatagatgaaaagattttctgttgtcatggaggcctttcacctgat
ctgcaatccatggaacagattcgacgtattatgcgtccaacggatgtaccagaccaaggc
ctactttgcgatcttctctggtccgatccagataaggatgttactggctggggtgagaat
gatcgaggtgtttcgtttaccttcggtcctgaagttgtggcgaagttcctgcataagcat
gatttggatctcatttgtcgcgctcatcaggttgtagaggatggttatgaattttttgcc
aagaggcaattggtaacattgttctccgcaccaaattactgtggagaattcgataatgcc
gggtcgatgatgacagtagatgaaacgctcatgtgctcttttcaaattttgaaaccagcg
gataaaaagaaattcccgtatagtggcgttggatctggccgtccagtgacaccaccgagg
accccggctccaaatgctaaaaaaggaaagaaatag

DBGET integrated database retrieval system