KEGG   Brugia malayi (filaria): Bm1_20495Help
Entry
Bm1_20495         CDS       T01050                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
bmy  Brugia malayi (filaria)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:bmy03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 212 aa AA seqDB search
MGDWDDDDFEVDVKQLDEKKHIIVDEEIGDKSEQNQSLNSTKSVPSKSKKKTDSPLNTFS
ADLNRELSGKEKEQLQRKADLKLAKDLFGIDEDETLTYSELTSLDEFRTFGENIGKMLLA
RSNATHFSEMLVSLLKVVLSHMDASKARVLSTVVKTIADEKTAVEKKAKGKGATKPTIRN
VSKSNTASVKAKKDLYDDYVSDEYDDYADHFM
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgggtgattgggatgatgatgatttcgaagttgatgtgaaacagctagatgaaaagaag
catattatagtagacgaagaaataggcgacaagtcagagcagaatcaatcgcttaattca
accaagtctgtaccatcgaaatcgaagaaaaagacagacagtccactgaacacctttagt
gccgacctcaatcgagaattgagtggaaaggaaaaggagcagctgcagaggaaagctgat
ctgaagcttgcaaaagatttatttggtattgacgaggatgaaacattaacttattcggaa
ttgacttccttggacgaatttaggacatttggtgagaatattggaaaaatgcttttagca
cgatcaaatgctacccatttttctgagatgcttgtttcacttctcaaagttgtcctttca
cacatggatgcgagcaaagcaagggttttgagtacggttgtaaaaactatagcggatgaa
aagacagcagttgagaagaaggcaaaagggaagggtgcaacgaaaccaacgataagaaac
gtcagtaagtcaaatacagcttcagttaaagcgaagaaagatttgtatgacgattatgta
tctgatgaatacgacgattatgccgaccattttatgtaa

DBGET integrated database retrieval system