KEGG   Brugia malayi (filaria): Bm1_20630Help
Entry
Bm1_20630         CDS       T01050                                 

Definition
ubiquitin C-terminal hydrolase UCH-L5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Bm1_20630
Peptidases [BR:bmy01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Bm1_20630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 301 aa AA seqDB search
MSDAGNWCLIESDPGVFTELIRGFGVSGVQVEELYSLDKQLFSDLKPVHGLIFLFKWRAG
EEPCGSLVLDNNRVFFAQQVIQNACATQALINLLLNTKTESGIVLGPILEEFKSFTQNFD
PMNRGLCLGNSEPIRKVHNSFSRQHLFELDIKAPEKEDNYHFITYIPVDGHIYELDGLRE
APLDLGAIREGEDWLDAVRPIINARIRKYSAGEIHFNLMAVISDRKMKYQKRLAELAESA
METDNKVEEMNHLQALIAAEEEKEKSFKAENIRRRHNYIKAQEKAIRKATEKKSEKSRVK
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatgctggaaactggtgcctaattgaatctgatccaggtgttttcactgaactg
attcgtggatttggtgtttctggtgtgcaagttgaagaactctatagtctagataagcag
ctattcagtgatctgaaaccggttcatgggttgatattcttatttaaatggcgcgcaggt
gaagaaccatgtggaagcttggtcctcgacaataatcgagttttctttgcacaacaagtg
atccagaatgcttgtgctacacaagcattaataaatttactactaaatacaaagacagaa
tcaggtatcgtgcttggtccaattctggaagaatttaaaagtttcacgcaaaattttgac
cctatgaatcgtggtttatgtctaggtaacagcgaaccaattaggaaagtccataacagt
ttttcacggcaacatctttttgaactggatattaaagctccggaaaaggaggataattat
catttcatcacgtacatacctgtggatggtcatatctatgaattggatggtcttcgtgag
gcacctctggatttgggtgctattagagaaggtgaagattggttggatgctgtgcggcca
atcatcaatgctaggatccgaaagtatagcgcaggtgaaattcacttcaatctaatggct
gttatttcggatcgaaaaatgaaataccaaaaacgtttagccgaactcgccgagtcagcg
atggagaccgataataaagtggaagaaatgaatcatcttcaggcactgattgctgctgag
gaagaaaaggagaaatcattcaaagcagaaaatattagacgtcgccataattacatcaaa
gctcaagaaaaagcaattcgtaaagcaacagagaaaaaatcggaaaaatcgagagttaaa
atctaa

DBGET integrated database retrieval system