KEGG   Brugia malayi (filaria): Bm1_20705Help
Entry
Bm1_20705         CDS       T01050                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
bmy  Brugia malayi (filaria)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Bm1_20705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1381 aa AA seqDB search
MRTVSVALVLCLNIGVDPPDVHRPNPCARKECWIDPLGINPQKAVLKIANALQKSYERWQ
PRARYKTANDPTVDDVRRLCQSLRRNAKDERILFHYNGHGVPRPTENGEIWVFNKNFTQY
IPLSIFDLQSWMGHPAVYVWDCHCAGLAIRSFFRFAEDHEKEWVKQLDEHMETRPPPLPI
IQTEMSLEEKASAFGFRKKPNFKECIHIGACGDHELLPMDSRLPADLFTSCILTPIQISV
LWYILKNHLEDRFPVTIVDKIPGQLSDRRTMLGELNWIFTAITDTIAWSSLPKELFQKLF
RLDLLLASVFRSFVLANRVMRENQCHVVSRPSLPSVHSHPLWDAWDYTIDLCLSQIQGFT
TPKQKLWSVAKEIYFSRSSVRHELLIDVTSQLAPINEADYTHNWFFIEQLQAFEVWLKYG
GERRTPPQQLPVVLQVLLSQVHRVKALELLARFLDLGSWAVGHALSVGIFPYVLKLLQSA
TKELRPWLAFIWAKILAVETSCQVDLIKDKERGYMYFLTILNDPSTNPRQKIVPAFVMAA
LIENNYRPAQELLTDNRYVTLCIELLSDVALRQCRLLRLWLLIGLGRLWADYDDARWQAI
RLAAYERVLEFLDDSVPEVRAAAVYAIGCLVRNKSENIEHATIIDHEVCDKLSMKCTFDG
SVLVRAELVVAMQWFIIDFENRFASLSMDLNEKIEQRKFRERKLSAGEQEMKPLRSIDEE
DDAFVSRGYDRSLPRSASRRRAHFLETPLNSPRRSNSMNFVSGVVADKVCAQWKSMFDTG
SLNDFSTKLLASTKEMRNENFKYKAIKQIEFLGSKTFNDQSERIWLSLLKLSLDPVNKIA
EMAQVLIEHVDKLATTRNERKRKLNCVERVSLAKQTESYPAEIVTFTVGSPTLDLSATPP
FVEDHICRNSENTLILDSRRQEQLPAFHQSSIFTPKRNMYSPTIKSMTKLDESSSTDREP
VVALVTTEFVPWCTRRFTEPILDVIQGEVGDGIADRLATHSMPSDWASHKDEGLQQTSKK
EIRALKEEGLFFDGHPLIVKTDAVSKCLAWSQIRPHLYSCDGEAVTIWRCELQRLYDVRK
FLCHNNNPFVNDIVTDLHVINEMTRELVVTCSDDGLMRIWDPGYSIYSHDFEAEQQMITA
AYLLKDVPISIPMNKHLASVFSWNQKCGLMAVSGNVKVCRLWDAHAEKSMQEIQIGAKNC
AVTKLSLDNSGSNLLAVGLSDGLVNVYDPRLPDKSRRTMSSRELEKPVIGLSLFSNLAGE
SSEGNLRLIAGSRDGEIRLWEPRMFKEPVVSFNACSFPKKDSLTNMEVHVHSQCIGCMDD
ASMVKLFDLNGKQLGEIRQDDWLVSGRIGTLISMRFHQLLVSLAVATENQTISFYRMPDL
S
NT seq 4146 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagtatcggtggcccttgtgttatgtttgaatattggtgtggacccgccagat
gttcataggccgaatccatgtgcgcggaaagagtgttggattgatccactgggaataaat
cctcagaaagctgttcttaaaattgctaatgctctgcagaaaagttatgaacgttggcaa
ccacgtgcaaggtataaaacggcaaatgatccaacagtggatgatgttcgacgtttatgc
caaagtttgcgacgaaacgccaaagatgaacgtattctatttcattacaatggacatggt
gtcccaagaccgactgaaaatggtgaaatatgggttttcaacaaaaatttcactcagtac
atcccgctttcgatttttgacttacagtcgtggatgggtcatccggccgtgtacgtctgg
gattgccattgtgctggtctagctataagatctttctttcgctttgctgaagatcatgaa
aaagaatgggttaaacaactcgatgaacatatggaaacgcgtccaccaccattacccatt
attcaaaccgaaatgagtcttgaagaaaaggcatctgcttttggattccggaagaagcca
aattttaaagaatgtattcacattggagcatgcggagaccatgaattacttccaatggat
tcaagacttccggctgatcttttcacgtcctgtattttaacaccaatccaaatttcggtg
ttgtggtatatcttgaaaaatcatttggaggatcgatttcccgtaacaatagttgataag
atccctggtcaactcagtgatcgtcgaaccatgcttggcgagttgaattggatattcaca
gcaattaccgacacgattgcatggagttcacttccaaaagaattgtttcagaaactattt
cgattggatttactacttgcatcagtatttcgaagttttgtattggctaaccgagtaatg
cgcgaaaatcagtgtcatgtcgtttctcgtccttccttaccatctgttcatagtcatcct
ctttgggatgcttgggattataccatcgatttatgtctaagccaaattcagggcttcaca
acaccaaaacagaaactttggtctgttgcaaaagaaatatatttctcacgttcatccgtt
cgtcatgaattgcttattgatgtgacttcacagcttgcaccgataaatgaagcagattac
actcataattggtttttcattgaacagttacaagcattcgaagtttggcttaaatatggt
ggtgaaaggcgaactcctccacagcagcttcctgttgttttacaagtacttctcagtcag
gtacatcgagtgaaagcgctggagcttttggctcgctttctagatttgggctcatgggcc
gtaggccatgccctctctgtcggtatatttccttatgttctgaagttgcttcaaagtgca
acaaaggaattgagaccatggttggcgttcatctgggcaaaaattcttgctgtagaaaca
agttgtcaagtggacctgattaaggataaagagcgaggatatatgtactttttaacaatc
ttgaacgatcctagtactaatccgcggcaaaaaattgtcccagcatttgtaatggctgca
ttaattgaaaacaactatagacctgcacaagagttgctaaccgataatagatatgtaaca
ctttgtatcgagcttctgtcagatgtagctctgcgacaatgcagattgcttcggttatgg
ttacttattggtcttggacgactctgggctgattatgatgatgccaggtggcaggcgatt
agattggccgcttatgaaagggttcttgaatttctggacgattcagttccggaagtacgt
gctgctgcagtctatgcaattggatgtcttgtgagaaataagtcggaaaatatcgaacac
gccacaattattgaccatgaagtttgtgataaactttcgatgaaatgcacttttgatggt
tcagtacttgttcgcgctgaattagttgtggcaatgcagtggtttattattgattttgaa
aatcgttttgccagtctgtcaatggatcttaatgaaaaaattgaacagaggaaattcagg
gaaagaaaactttcggcaggtgaacaggaaatgaaacctttgcgttcaattgatgaagaa
gatgatgcatttgtttctcgcggttatgatcgcagtcttccaagatctgcatctcgaaga
cgagctcatttcctggaaactccattaaattcacctcgaagatcaaattcaatgaatttc
gtttctggagtggttgcggataaagtttgtgcacagtggaagtcgatgtttgataccggt
tcactgaatgatttttccactaaactactggcttccacaaaggaaatgcgcaacgaaaat
ttcaagtataaagctattaagcagattgaattcttgggatcaaaaacattcaatgatcaa
tctgaacgtatctggttgtcacttcttaagctttctctagatcctgtaaacaaaatcgct
gaaatggcacaagtattaattgaacatgttgacaaattagcaacaacaaggaatgagaga
aaaagaaagctgaattgtgttgaacgggtatcgttggccaagcagactgaatcatatcct
gcggaaatagtaacatttactgttggttcaccaacattggatttgtcagcgacaccgcct
tttgtagaagatcatatctgtaggaattcagaaaatacattgattttggattcacgacgt
caagaacagctcccagcgttccatcagtcctcaatcttcacgcctaagcgaaatatgtat
tcacccacaatcaaaagcatgacaaaactggatgaaagttcttctacagacagggaaccg
gtagttgctctagtaacaacggaatttgtaccctggtgtacgaggcgatttactgaacca
attttggatgtaatacagggagaagttggtgatggcatagctgatcgtttggctactcat
tccatgcctagtgattgggcatcgcataaagatgaaggtttgcagcaaacttcgaaaaag
gaaattcgggcacttaaggaagagggattatttttcgacggccatccactgattgtaaag
acagatgcggtaagcaaatgtttggcttggagtcaaataagacctcacttatattcatgc
gatggcgaagcagtgactatttggcgatgcgaattacagcgattgtacgatgtccgaaag
tttttgtgtcacaacaataatcccttcgttaatgatatagttactgatctacacgtaata
aatgaaatgacacgtgaattggtagtgacttgtagtgatgatggattgatgagaatttgg
gatccaggatattccatctattcccatgatttcgaggcggaacagcagatgataacagct
gcttatctgctaaaagatgtgccgattagcattccaatgaataagcatctcgcatcggtt
tttagttggaatcagaaatgtggccttatggcagtttctggtaatgtgaaggtgtgtcgt
ttgtgggacgcccatgcagaaaaaagtatgcaagagattcagattggtgctaaaaattgt
gctgtcacaaaattgagtcttgataattcagggagtaatcttcttgctgttggtctgagt
gatggattagtgaatgtctacgatccaagattacctgataaatcgcgacgtacaatgtca
tctcgagagcttgaaaaaccagttattggattatcacttttttctaatctggctggtgaa
tcttctgaaggaaacctgagactaatcgctggttcaagagatggcgaaatacgtttgtgg
gagccacgaatgttcaaggaaccggtagttagttttaacgcttgcagcttcccaaagaaa
gacagcttaacgaatatggaagttcatgtccacagtcagtgtattggttgtatggatgat
gcttccatggtaaagttgtttgatctgaacggcaaacagctaggtgaaattcgtcaggat
gattggttagttagtggtcggatcggaacattgatatcaatgcgttttcatcagctactt
gtctcattagcagttgctactgaaaatcaaacaattagtttttatcgaatgccggattta
tcgtga

DBGET integrated database retrieval system