KEGG   Brugia malayi (filaria): Bm1_21375Help
Entry
Bm1_21375         CDS       T01050                                 

Definition
Ubiquitin carboxyl-terminal hydrolase family protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
bmy  Brugia malayi (filaria)
Brite
Enzymes [BR:bmy01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Bm1_21375
Peptidases [BR:bmy01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Bm1_21375
Transcription machinery [BR:bmy03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Bm1_21375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 498 aa AA seqDB search
MNSPCKHIGINQRALSKTLNSVVYAVIFPNNAKAREVHARYIRCIQCKTRLNALMCACCQ
CSTFACLTHIHDHMAAKEHLFAVSVETGFIYCYQCGDFVYDRGMEDARRDAENGCRRSLN
LSTRSIWYPGAAVVDVCHDDPTRMVRFSRSSIRGLRGLVNLGNTCFMNCIIQAIVHTPHL
KDYFLTDQHHCASSSSHSKAQCLMCELANTFQEFYKGDVTPYKPNRFLNLVWTHARHLAG
YEQQDAHEFFIAALDVLHRHSGSSSLPSTPNECNCIIDWIFTGKLQSDLTCSICGCVSTT
VDPFWDISLDVAQEVLRSPSSSSGSPQQITLEDCLHRYIMPEHLGSNAKTKCARCETYEE
STKQLTLKTLPMVACFHLKRFEHSHKDRKKMDTKIKYPQFIDMTPFTASFRERSSGAPES
RTSIVTDLLTTNRNKYELFAVVNHLGTMESGHYTCYIRHQRNQWFQCDDQKVTKVPTERV
LSSQGYLLFYHKCHADYY
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtccatgtaaacacattggtataaatcagcgagcgttatcgaaaacccttaat
agtgttgtttatgcagttatatttcccaataatgctaaagcacgagaagttcatgctaga
tatattagatgtattcagtgtaaaacacgattgaatgcattaatgtgcgcatgttgtcaa
tgttcaacatttgcatgtttaacacatatacacgatcatatggcagccaaagagcatctc
ttcgcggtttctgttgaaacaggttttatttattgttaccaatgtggtgattttgtatac
gatcgtggtatggaggatgctcgacgtgatgccgaaaatggttgccgacgatcattaaac
ttaagtactcggagtatttggtatccaggtgcagctgttgttgatgtatgtcatgatgat
ccaactcgaatggttcgattttcgaggagtagtatcagaggtttacgtggattggtgaat
ttagggaatacgtgtttcatgaattgtattatacaagctattgtacatactccacattta
aaggattatttccttactgatcagcatcattgtgcgtcatcgtcatcacatagcaaagct
cagtgtctcatgtgtgaacttgctaatacttttcaggagttttacaaaggtgatgtaaca
ccttacaagccaaatcgatttctgaatcttgtctggacacatgcaaggcatttggctggc
tacgaacaacaggatgcacatgaattctttatcgctgcccttgatgtacttcatcgacat
tccggaagtagctcacttccttcaacgccaaatgaatgtaattgtattattgattggatc
tttaccggcaaattacaatctgatctcacatgctcaatttgtggatgtgtatcaacaact
gttgacccattctgggatatatcacttgatgtggctcaagaagtgttacgttctcccagc
agtagttctggttcaccacaacaaattactttggaagattgcttacataggtatataatg
cccgaacatttgggaagtaatgcaaaaaccaaatgtgctcgttgtgaaacatacgaagag
tcaacgaagcaactcaccttaaaaactcttccaatggttgcctgctttcatttgaagcgt
tttgagcatagtcacaaagatcggaagaaaatggacacaaaaatcaaatatcctcaattt
attgatatgactccgttcacggcttcatttcgtgaacgttccagcggtgctccagagagc
agaactagtatagtcaccgatttgcttacaacaaatcgaaataaatacgaactgtttgca
gttgtgaatcatttgggtacgatggaaagtggtcattatacatgttatatccggcatcaa
cgtaatcagtggtttcaatgtgatgatcaaaaagttacaaaagtacctacggaacgagtc
ctttcatctcaaggctatttgttgttttatcataaatgtcatgctgattattattaa

DBGET integrated database retrieval system