KEGG   Brugia malayi (filaria): Bm1_21545Help
Entry
Bm1_21545         CDS       T01050                                 

Definition
Probable clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
bmy  Brugia malayi (filaria)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:bmy00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Bm1_21545
   04142 Lysosome
    Bm1_21545
Exosome [BR:bmy04147]
 Exosomal proteins
  Proteins found in most exosomes
   Bm1_21545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1694 aa AA seqDB search
MSSLLPIKFQEHILLQSLGINAANIGFATLTMESDKFIVVREKVGENAQVVIVDMNDVNN
PLRRPITADSVIMNPATKVLALKSSRTLQIFNIELKTKMKAYNMPEDVIFWKWVNVNTIA
LVSETAAYHWSLQGDSPPVKMFERHSTLSGFQIINYRADAECKWLLVIGIAAKDNRVVGA
MQLYSTERKVSQPIEGHAACFVSFKTEGNPHPSNLFCFSVRTIQGGKLHVIEIGSPPAGN
QPFQKKQVEVYYPAEAATDFPVAMQASSKHGIIYLVTKYGYVHLYDIETAVCIYMNRISS
ETIFVTAEYTATEGIIGVNRKGQVLSVSIDEQNMIPYVTQTLQNPELALKLAVRCDLPGA
EELFVRKFNLLFGNGNYAEAAKVAATAPQGILRTPQTIQKFQQCPHTGGGPSPLLQYFGI
LLDQGQLNKYETLELCRPVLAQGRKQLLEKWLTEGKLECTEELGDLVRPHDVNVALSVYL
RGNVPHKVVQCFAETGQFDKIILYAKKVNFEPDYLFQLRQVLRSNPEMGAKFAQMLVSEG
ENEPLADINQIVGCFEEVQAVQPCTSFLLEVLKSDKESEGHLQTKLLEMNLLYAPQVADA
ILGNQMFHHYDRATIGQLCEKAGLLQRALEHFTDLYDIKRTVVHTQHLKPDWLVNYFGQL
SVEDSLECLKAMLQTNMRQNLQIVVQIATKYHEQLTTHALIDLFESFKSYEGLFYFLGSI
VNFSQDPEVHFKYIQAATRTGQIKEVERICRESNCYEAERVKNYLKEAKLTDQLPLIIVC
DRHDMVHDLVLYLYRNNLQKYIEVFVQKVNPARLPIVVGGLLDVDCSEDAIKQLIINTRG
KFDIDELVDEVEKRNRLKLLAPWLEMRVQEGTVDPATHNALAKIYIDANNNPERFLRENP
YYDSRIVGKYCEKRDPHFACLAYERGQCDAELVNVCNENSLFKNLARYLVKRRDFPLWAQ
VLAEDNQHRRQLIDQVVQTALSETQDPEDISATVKAFMAADLPNELIELLEKIVLDNSVF
SEHRNLQNLLILTAIKADRTRVMEYIQKLDNYDAPDIANIAVSNQLYEEAFAIFKKFDVN
TAAINVLIDNVSNLDRAYEFAERCNEPGVWASLAKAQLKEGLVKEAVDSFIKADDPTAYM
EVVSKCSETGNWEDLVRYLQMARKKSRESYIETELVYAYAKTNRLADLEEFISGPNHAQI
QQIGDRCFDSGMYEAAKILHNNISNFAKLSVTLVRLNEFQGAVDAARKANSTKTWKQVCF
ACVDNEEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELIGLLEAALGLERAHMGMFT
ELAILYSKYKAEKMREHLELFWSRVNIPKVLRAAEQAHLWSELVFLYDKYEEYDNAAQTM
MQHPVEAWREQHFKEVITKVANIELYYKAMQFYLDYKPMLLNDLLLVLTPRLDHSRTVSF
FAKLNQLPLVKPYLRQVQTQNNKSVNEALNQVLIDEEDYTGLRSSIDAYDNFDNITLAQQ
LEKHELLEFRRISAYLYRGNNRWKQSVELCKKDKLYKDAMEYAAESRQPEIAEELLAYFL
ENKLHDCFAASLYQMYDLLHPDVILELAWKHKIMDFAMPYMIQVMRDYHSRIGKLERAEA
ERKEEIQGNQQPNGSMMEPQLMLTFPGGAPISSVPQMSAAYGGVTVSSTPYGATVPATNA
YGTPMYPSSGSYAM
NT seq 5085 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcactcttaccgatcaaatttcaagagcatattttgttacaaagtttgggtata
aatgcggcaaatatcggattcgcaacgttaacaatggaatcggacaaatttattgttgta
agagaaaaagttggtgagaatgctcaggttgttattgttgatatgaatgatgtcaacaat
cctcttcgtcgaccaatcactgcagattcggtaataatgaatcctgcaacaaaagttcta
gctttaaagtcgtcccgtacccttcaaattttcaacatcgaactgaaaactaaaatgaaa
gcctacaatatgccagaagatgtgatcttttggaaatgggtcaatgttaatacgattgca
ttagtatcagaaactgcagcatatcattggtcactacaaggtgattcacctccagtaaaa
atgttcgaaagacattcaacattgagtggatttcaaataattaattatcgagcagacgca
gaatgtaaatggttgttggtgattggaattgctgctaaggataatcgtgtggttggtgca
atgcagttgtatagtacagagaggaaagtatcacaaccaattgaaggtcatgcagcatgc
tttgtgagctttaaaactgaaggaaatccacatcctagtaatttattctgcttctctgtt
cgaactatccaaggtggaaagcttcatgttatcgagataggtagcccaccagctggtaat
caaccctttcaaaagaaacaggtggaagtatattatccagctgaagctgctactgatttc
ccggttgcaatgcaggcttcatcaaagcatggtatcatatatttggtgacgaaatatggc
tatgtgcatttatatgatatcgagacagcagtatgcatttatatgaatcgaatctcatca
gaaactatcttcgtcactgctgaatatactgctaccgaaggaataattggcgtaaatcgg
aagggacargttctctcagtaagtattgatgagcaaaatatgatcccttacgtgacacaa
acattgcaaaatccrgagcttgcattgaaattagcagtacgttgcgatcttccaggagct
gaggaattatttgttcgtaaattcaatctacttttcggtaatggaaattatgctgaagct
gcaaaagttgctgcaactgctcctcaaggcattttaaggacaccgcaaacaattcagaag
ttccaacagtgtccacatacaggcggtggaccaagtcctctactccagtattttgggata
ttacttgatcaggggcaactgaataagtatgaaacgttggagctgtgccgaccggtgcta
gcacagggaaggaagcaattgttggagaaatggcttactgagggaaagttggaatgcact
gaagaattgggggatctggttcgtccacatgatgtcaacgttgcactgtctgtttatctt
cgtggtaacgtacctcataaggttgtacaatgcttcgctgaaacaggacagttcgataaa
attattttgtatgctaaaaaagtgaacttcgaacctgactacttgttccaacttcgacaa
gtattacgttcaaatccagagatgggagctaaatttgcacaaatgcttgtatctgaaggc
gaaaatgagccactagctgatattaaccagatagttggatgtttcgaggaagtacaagca
gtacaaccatgtacatcgttcttgcttgaagtactgaaaagtgataaggagtcggaggga
catcttcaaacaaaattgcttgaaatgaatcttctttatgctccacaggtagcagatgca
atattaggtaatcagatgtttcatcattacgatcgtgcaacgattggacagttgtgtgaa
aaagcaggtttattgcaacgagctttggagcacttcactgacctttacgatatcaaaaga
accgttgtccatacccaacatcttaaacctgattggctagtgaattactttgggcagttg
tcagtggaggattcactggaatgtttgaaagcgatgctacaaacaaacatgcggcagaac
ttgcaaattgttgttcagatagctactaaataycatgaacagcttactacccatgcgctc
attgatctatttgagtcgttcaaaagctacgaaggactgttttactttttaggctctatt
gtcaatttttcgcaagatcctgaagttcattttaaatacatccaggctgctactagaact
ggacaaatcaaagaagtagaaagaatttgtcgtgaatcaaactgctatgaagcagaacga
gttaaaaattatttaaaagaggctaaattaacggaccaattgcctctgatcattgtatgc
gatcgacatgatatggtgcacgatcttgtcctttatctttatcgaaacaatctgcagaaa
tacattgaggtgttcgtacagaaggtaaatccggcacgactacctattgttgttggtggt
ttgctggatgtagattgctcggaagatgcaatcaaacaactcatcatcaatacaagagga
aaatttgatattgacgaactagttgacgaagtcgaaaagaggaacagattgaaactatta
gcaccatggctagagatgcgtgttcaggagggaactgttgatccagcaacgcacaatgct
cttgctaaaatctatattgatgccaataataatcctgaacgatttcttcgtgaaaatcca
tattatgattcgcgaattgttggaaaatattgtgaaaaaagagacccacactttgcatgt
cttgcatatgaacgtggccaatgtgatgctgaacttgttaatgtgtgtaacgaaaattcg
ctttttaaaaatttagcgcgatacctagttaagcggcgtgactttccactttgggctcag
gtattggctgaagacaatcaacatagaaggcaattaattgatcaggtagttcaaacggct
ctttcggaaactcaagatccagaagatatttcagcaacggtaaaagcttttatggctgct
gatttgccgaatgagctaattgagttattggaaaaaattgtccttgacaactctgtcttt
tcagagcataggaaccttcaaaatttactcattttgacagcaattaaagcagaccgtaca
cgtgtcatggaatacatccagaagttggacaattacgatgcaccggacatcgccaatatt
gctgtttccaaccagttatatgaagaagcatttgccattttcaaaaaatttgatgtcaat
actgcagcaatcaatgttttgattgataatgtgtccaatttggatcgtgcttatgaattt
gcggaacgatgtaatgaacctggcgtttgggcgtcattggcgaaagcgcagttgaaagag
ggtttagtaaaagaagctgtagattcattcattaaagccgatgatcccactgcatatatg
gaagttgtgagcaaatgttcagaaactggaaactgggaggatttggttcgatatttgcaa
atggcacgaaaaaaatcgagagaatcatacatagaaacagaacttgtctatgcttacgca
aaaacaaatcgtcttgctgacttggaggaattcatttcgggacctaatcatgctcaaatt
caacaaataggtgatcgatgttttgacagtggaatgtatgaagcagccaaaattcttcat
aacaatatatcgaattttgcaaaattatcagtcacacttgttcggcttaatgaatttcaa
ggtgcagttgatgctgctcgaaaagcaaattcaacgaagacatggaagcaagtttgtttt
gcttgtgttgataatgaagaatttcgtttggcacagatgtgcggtcttcatattgtcgta
catgcagatgaactcgaggaattaattaattactatcaggatcgaggatacttcgaagaa
ttaattggtctgctagaggcagcactaggtttggaaagagcacatatggggatgtttact
gaattagcaatcctttacagtaaatataaagctgagaaaatgcgtgagcatcttgagctg
ttttggagtcgagtaaatattccgaaggttctgcgtgctgcagaacaagctcatttatgg
tctgagcttgtctttctttatgataaatatgaagaatacgataatgcggctcaaacgatg
atgcaacatccagtggaagcatggcgagagcagcacttcaaggaagtgatcactaaggtg
gcgaatattgaactgtattataaggcgatgcaattctatttggattataaacctatgcta
ttgaatgatctacttcttgtattaacaccacgacttgatcattcgcgaactgtatcattc
tttgctaagttgaatcagctgcctctcgtgaaaccatatttacgtcaagtgcaaacacaa
aataacaaatcagtgaacgaggctttaaatcaagtgctcattgatgaagaagattatact
ggtcttcgctcttctattgatgcttatgacaactttgataatattaccttggcacaacaa
cttgaaaaacacgaattgcttgaatttagacgtatatctgcgtatttatataggggaaac
aataggtggaaacaaagcgttgagctatgcaagaaggacaaattgtacaaagatgcaatg
gaatatgctgcggaatcgcgacaacctgaaatagcggaagaattattagcatattttctc
gaaaataaattacacgattgttttgcagcttcactttatcaaatgtatgacttgttgcac
ccggatgttatattggaattagcrtggaaacataaaattatggactttgcgatgccttat
atgattcaagtaatgcgcgattatcatagcaggattggaaagttggaaagagctgaagca
gaaagaaaagaagagattcaaggaaatcagcaaccaaatggaagcatgatggaaccacag
ttaatgttgacatttcctggtggtgcaccgataagttcagtaccacaaatgtctgcagca
tacggtggtgtaacagtatctagcactccttacggtgctactgtaccagcaacgaatgct
tatggaacaccgatgtatccaagtagtggttcatatgccatgtag

DBGET integrated database retrieval system